RegulonDB RegulonDB 10.8: Gene Form
   

mppA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mppA ynaI pgrR anti-anti-terminator mppAp4 mppAp4 mppAp9 mppAp9 mppAp13 mppAp13 mppAp5 mppAp5 TSS_1754 TSS_1754 ycjYp6 ycjYp6

Gene      
Name: mppA    Texpresso search in the literature
Synonym(s): ECK1326, G6665, b1329, ynaH
Genome position(nucleotides): 1393227 --> 1394840 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.96
External database links:  
ASAP:
ABE-0004460
ECHOBASE:
EB3158
OU-MICROARRAY:
b1329
PortEco:
mppA
STRING:
511145.b1329
COLOMBOS: mppA


Product      
Name: murein tripeptide ABC transporter periplasmic binding protein
Synonym(s): MppA, YnaH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 59.9
Isoelectric point: 8.741
Motif(s):
 
Type Positions Sequence
187 -> 285 FPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVY
23 -> 537 AEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH
29 -> 68 TVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEG
69 -> 186 LVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAF
77 -> 453 EIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTST

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:1900750 - oligopeptide binding
GO:1904680 - peptide transmembrane transporter activity
biological_process GO:0015031 - protein transport
GO:0015833 - peptide transport
GO:0015834 - peptidoglycan-associated peptide transport
GO:0042939 - tripeptide transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Bina X., et al., 2003
[2] Li H., et al., 1999
External database links:  
ECOCYC:
G6665-MONOMER
ECOLIWIKI:
b1329
INTERPRO:
IPR000914
INTERPRO:
IPR030678
INTERPRO:
IPR039424
INTERPRO:
IPR023765
MODBASE:
P77348
PANTHER:
PTHR30290
PDB:
3O9P
PDB:
4TOZ
PFAM:
PF00496
PRIDE:
P77348
PRODB:
PRO_000023278
PROSITE:
PS01040
REFSEQ:
NP_415845
SMR:
P77348
SWISSMODEL:
P77348
UNIPROT:
P77348


Operon      
Name: mppA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1754 1392990 reverse nd [RS-EPT-CBR] [3]
  promoter mppAp5 1393054 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter mppAp13 1393121 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter mppAp9 1393139 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter mppAp4 1393204 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bina X., Perreten V., Levy SB., 2003, The periplasmic protein MppA requires an additional mutated locus to repress marA expression in Escherichia coli., J Bacteriol 185(4):1465-9

 [2] Li H., Park JT., 1999, The periplasmic murein peptide-binding protein MppA is a negative regulator of multiple antibiotic resistance in Escherichia coli., J Bacteriol 181(16):4842-7

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB