RegulonDB RegulonDB 10.8: Gene Form
   

abgB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

abgT abgB abgA abgR NarL Fis NarL NarL NarL terminator ogtp ogtp

Gene      
Name: abgB    Texpresso search in the literature
Synonym(s): ECK1333, G6669, b1337, ydaI
Genome position(nucleotides): 1401810 <-- 1403255 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.56
External database links:  
ASAP:
ABE-0004491
ECHOBASE:
EB3134
OU-MICROARRAY:
b1337
PortEco:
abgB
STRING:
511145.b1337
COLOMBOS: abgB


Product      
Name: p-aminobenzoyl-glutamate hydrolase subunit B
Synonym(s): AbgB, YdaI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.194
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
80 -> 252 GEYDALAGLSQQAGCAQPTSVTPGENGHGCGHNLLGTAAFAAAIAVKKWLEQYGQGGTVRFYGCPGEEGGSGKTFMVREGVFDDVDAALTWHPEAFAGMFNTRTLANIQASWRFKGIAAHAANSPHLGRSALDAVTLMTTGTNFLNEHIIEKARVHYAITNSGGISPNVVQAQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016805 - dipeptidase activity
GO:0046982 - protein heterodimerization activity
GO:0071713 - para-aminobenzoyl-glutamate hydrolase activity
biological_process GO:0006508 - proteolysis
GO:0046657 - folic acid catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9029N
ECOCYC:
G6669-MONOMER
ECOLIWIKI:
b1337
INTERPRO:
IPR002933
INTERPRO:
IPR036264
INTERPRO:
IPR017439
INTERPRO:
IPR017145
MODBASE:
P76052
PFAM:
PF01546
PRIDE:
P76052
PRODB:
PRO_000022028
REFSEQ:
NP_415853
SMR:
P76052
UNIPROT:
P76052


Operon      
Name: abgABT-ogt         
Operon arrangement:
Transcription unit        Promoter
ogt
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB