RegulonDB RegulonDB 10.8: Gene Form
   

abgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

abgT abgB abgA abgR NarL Fis NarL NarL NarL terminator ogtp ogtp

Gene      
Name: abgA    Texpresso search in the literature
Synonym(s): ECK1334, G6670, b1338, ydaJ
Genome position(nucleotides): 1403255 <-- 1404565 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.23
External database links:  
ASAP:
ABE-0004493
ECHOBASE:
EB3135
OU-MICROARRAY:
b1338
PortEco:
abgA
STRING:
511145.b1338
COLOMBOS: abgA


Product      
Name: p-aminobenzoyl-glutamate hydrolase subunit A
Synonym(s): AbgA, YdaJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.588
Isoelectric point: 5.753
Motif(s):
 
Type Positions Sequence
231 -> 318 FDAHFTGTAAHAGAKPEDGHNALLAAAQATLALHAIAPHSEGASRVNVGVMQAGSGRNVVPASALLKVETRGASDVINQYVFDRAQQA
112 -> 428 AFRVDMDALDLSEEQDVSHRPYRDGFASCNAGMMHACGHDGHTAIGLGLAHTLKQFESGLHGVIKLIFQPAEEGTRGARAMVDAGVVDDVDYFTAVHIGTGVPAGTVVCGSDNFMATTKFDAHFTGTAAHAGAKPEDGHNALLAAAQATLALHAIAPHSEGASRVNVGVMQAGSGRNVVPASALLKVETRGASDVINQYVFDRAQQAIQGAATMYGVGVETRLMGAATASSPSPQWVAWLQSQAAQVAGVNQAIERVEAPAGSEDATLMMARVQQHQGQASYVVFGTQLAAGHHNEKFDFDEQVLAIAVETLARTAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016810 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0016805 - dipeptidase activity
GO:0046982 - protein heterodimerization activity
GO:0071713 - para-aminobenzoyl-glutamate hydrolase activity
biological_process GO:0006508 - proteolysis
GO:0046657 - folic acid catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6670-MONOMER
ECOLIWIKI:
b1338
INTERPRO:
IPR033845
INTERPRO:
IPR036264
INTERPRO:
IPR017439
INTERPRO:
IPR011650
INTERPRO:
IPR002933
MODBASE:
P77357
PFAM:
PF07687
PFAM:
PF01546
PRIDE:
P77357
PRODB:
PRO_000022027
REFSEQ:
NP_415854
SMR:
P77357
UNIPROT:
P77357


Operon      
Name: abgABT-ogt         
Operon arrangement:
Transcription unit        Promoter
ogt
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB