RegulonDB RegulonDB 10.8: Gene Form
   

ydaG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

racR unknown ydaF ydaG sieB ydaSp3 ydaSp3 TSS_1775 TSS_1775

Gene      
Name: ydaG    Texpresso search in the literature
Synonym(s): ECK1353, G6679, b1355, gatA
Genome position(nucleotides): 1419322 <-- 1419456 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.41
External database links:  
ASAP:
ABE-0004544
ECHOBASE:
EB2092
OU-MICROARRAY:
b1355
PortEco:
ydaG
STRING:
511145.b1355
COLOMBOS: ydaG


Product      
Name: Rac prophage; uncharacterized protein YdaG
Synonym(s): GatA, YdaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 5.194
Isoelectric point: 4.635
Motif(s):
 
Type Positions Sequence
6 -> 35 VVQYLMDCCGITYNQAVQALRSNDWDLWQA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6679-MONOMER
ECOLIWIKI:
b1355
INTERPRO:
IPR009060
PFAM:
PF14555
PRIDE:
P76061
REFSEQ:
NP_415873
UNIPROT:
P76061


Operon      
Name: ydaGF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1775 1419829 reverse nd [RS-EPT-CBR] [1]
  promoter ydaSp3 1420170 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB