RegulonDB RegulonDB 10.8: Gene Form
   

ydaV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydaU ydaV ydaW

Gene      
Name: ydaV    Texpresso search in the literature
Synonym(s): ECK1358, G6684, b1360
Genome position(nucleotides): 1421983 --> 1422729 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.74
External database links:  
ASAP:
ABE-0004560
ECHOBASE:
EB3147
OU-MICROARRAY:
b1360
PortEco:
ydaV
STRING:
511145.b1360
COLOMBOS: ydaV


Product      
Name: Rac prophage; putative ATP-binding protein YdaV
Synonym(s): YdaV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.128
Isoelectric point: 9.516
Motif(s):
 
Type Positions Sequence
59 -> 219 LNRSGIQPLHRKCSFSNYQVQNEGQRYALSQAKSIADELMTGCTNFAFSGKPGTGKNHLAAAIGNRLLKDGQTVIVVTVADVMSALHASYDDGQSGEKFLRELCEVDLLVLDEIGIQRETKNEQVVLHQIVDRRTASMRSVGMLTNLNYEAMKTLLGERIM

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005524 - ATP binding
biological_process GO:0006260 - DNA replication
GO:0006271 - DNA strand elongation involved in DNA replication
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48163N
ECOCYC:
G6684-MONOMER
ECOLIWIKI:
b1360
INTERPRO:
IPR028350
INTERPRO:
IPR002611
INTERPRO:
IPR027417
MODBASE:
P77546
PFAM:
PF01695
PRIDE:
P77546
REFSEQ:
NP_415878
SMART:
SM00382
SMR:
P77546
UNIPROT:
P77546


Operon      
Name: ydaSTUVW-rzpR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB