RegulonDB RegulonDB 10.8: Gene Form
   

ydaW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydaV ydaW rzpR rzoR

Gene      
Name: ydaW    Texpresso search in the literature
Synonym(s): ECK1359, G6685, b1361
Genome position(nucleotides): 1422752 --> 1423312 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.84
External database links:  
ASAP:
ABE-0004562
ECHOBASE:
EB3148
OU-MICROARRAY:
b1361
PortEco:
ydaW
STRING:
316407.85674925
COLOMBOS: ydaW


Product      
Name: Rac prophage; putative uncharacterized protein YdaW
Synonym(s): YdaW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.05
Isoelectric point: 5.347
Motif(s):
 
Type Positions Sequence
88 -> 151 IEQRGPQTADELATLFGTTSRKVASTLAMAISKGRLIRVNQGGKFRYCIPGDNLPAEPKAASVS

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6685-MONOMER
ECOLIWIKI:
b1361
INTERPRO:
IPR012432
INTERPRO:
IPR036390
INTERPRO:
IPR036388
PFAM:
PF07789
PRIDE:
P76066
REFSEQ:
NP_415879
SMR:
P76066
UNIPROT:
P76066


Operon      
Name: ydaSTUVW-rzpR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB