RegulonDB RegulonDB 10.8: Gene Form
   

uspF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ompN uspF ynaM ttcC uspFp uspFp TSS_1782 TSS_1782 TSS_1781 TSS_1781 TSS_1780 TSS_1780 TSS_1779 TSS_1779 TSS_1778 TSS_1778 TSS_1777 TSS_1777

Gene      
Name: uspF    Texpresso search in the literature
Synonym(s): ECK1371, G6699, UP03, b1376, ynaF, yzzL
Genome position(nucleotides): 1435185 <-- 1435619 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.51
External database links:  
ASAP:
ABE-0004605
ECHOBASE:
EB2539
OU-MICROARRAY:
b1376
PortEco:
uspF
STRING:
511145.b1376
COLOMBOS: uspF


Product      
Name: nucleotide binding filament protein
Synonym(s): UspF, YnaF, YzzL
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 16.017
Isoelectric point: 5.868
Motif(s):
 
Type Positions Sequence
1 -> 144 MNRTILVPIDISDSELTQRVISHVEEEAKIDDAEVHFLTVIPSLPYYASLGLAYSAELPAMDDLKAEAKSQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAKKIPAHMIIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0005524 - ATP binding
biological_process GO:0006979 - response to oxidative stress
GO:0007155 - cell adhesion
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Nachin L., et al., 2005
External database links:  
DIP:
DIP-12739N
ECOCYC:
G6699-MONOMER
ECOLIWIKI:
b1376
INTERPRO:
IPR006015
INTERPRO:
IPR014729
INTERPRO:
IPR006016
MODBASE:
P37903
PANTHER:
PTHR46268
PFAM:
PF00582
PRIDE:
P37903
PRINTS:
PR01438
PRODB:
PRO_000024195
REFSEQ:
NP_415894
SMR:
P37903
UNIPROT:
P37903


Operon      
Name: uspF         
Operon arrangement:
Transcription unit        Promoter
uspF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1777 1434418 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1778 1434432 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1779 1434436 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1780 1434580 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1781 1434582 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1782 1434626 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nachin L., Nannmark U., Nystrom T., 2005, Differential roles of the universal stress proteins of Escherichia coli in oxidative stress resistance, adhesion, and motility., J Bacteriol 187(18):6265-72

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB