RegulonDB RegulonDB 11.0: Gene Form
   

paaZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tynA paaZ paaA PaaX SlyA CRP SlyA IHF SlyA PaaX FeaR FeaR anti-anti-terminator anti-terminator terminator paaAp paaAp paaZp paaZp tynAp tynAp

Gene      
Name: paaZ    Texpresso search in the literature
Synonym(s): ECK1384, G6708, b1387, maoC, ydbN
Genome position(nucleotides): 1451597 <-- 1453642
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.2
External database links:  
ASAP:
ABE-0004644
ECHOBASE:
EB3498
ECOLIHUB:
maoC
OU-MICROARRAY:
b1387
STRING:
511145.b1387
COLOMBOS: paaZ


Product      
Name: fused 3-oxo-5,6-dehydrosuberyl-CoA semialdehyde dehydrogenase and oxepin-CoA hydrolase
Synonym(s): MaoC, PaaZ, YdbN, oxepin-CoA hydrolase/3-oxo-5,6-dehydrosuberyl-CoA semialdehyde dehydrogenase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 73.003
Isoelectric point: 6.427
Motif(s):
 
Type Positions Sequence Comment
1 -> 333 MQQLASFLSGTWQSGRGRSRLIHHAISGEALWEVTSEGLDMAAARQFAIEKGAPALRAMTFIERAAMLKAVAKHLLSEKERFYALSAQTGATRADSWVDIEGGIGTLFTYASLGSRELPDDTLWPEDELIPLSKEGGFAARHLLTSKSGVAVHINAFNFPCWGMLEKLAPTWLGGMPAIIKPATATAQLTQAMVKSIVDSGLVPEGAISLICGSAGDLLDHLDSQDVVTFTGSAATGQMLRVQPNIVAKSIPFTMEADSLNCCVLGEDVTPDQPEFALFIREVVREMTTKAGQKCTAIRRIIVPQALVNAVSDALVARLQKVVVGDPAQEGVK UniProt: Aldehyde dehydrogenase; Sequence Annotation Type: region of interest.
27 -> 498 SGEALWEVTSEGLDMAAARQFAIEKGAPALRAMTFIERAAMLKAVAKHLLSEKERFYALSAQTGATRADSWVDIEGGIGTLFTYASLGSRELPDDTLWPEDELIPLSKEGGFAARHLLTSKSGVAVHINAFNFPCWGMLEKLAPTWLGGMPAIIKPATATAQLTQAMVKSIVDSGLVPEGAISLICGSAGDLLDHLDSQDVVTFTGSAATGQMLRVQPNIVAKSIPFTMEADSLNCCVLGEDVTPDQPEFALFIREVVREMTTKAGQKCTAIRRIIVPQALVNAVSDALVARLQKVVVGDPAQEGVKMGALVNAEQRADVQEKVNILLAAGCEIRLGGQADLSAAGAFFPPTLLYCPQPDETPAVHATEAFGPVATLMPAQNQRHALQLACAGGGSLAGTLVTADPQIARQFIADAARTHGRIQILNEESAKESTGHGSPLPQLVHGGPGRAGGGEELGGLRAVKHYMQRTA
143 -> 143 L UniProt: In strain: W..
256 -> 256 E UniProt: Catalyzes the formation of 3-oxo-5,6-dehydrosuberyl-CoA semialdehyde instead of 3-oxo-5,6-dehydrosuberyl-CoA..
440 -> 440 A UniProt: In strain: W..

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0016829 - lyase activity
GO:0016491 - oxidoreductase activity
GO:0016803 - ether hydrolase activity
GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0004300 - enoyl-CoA hydratase activity
GO:0016726 - oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
GO:0042802 - identical protein binding
GO:0016823 - hydrolase activity, acting on acid carbon-carbon bonds, in ketonic substances
biological_process GO:0008152 - metabolic process
GO:0010124 - phenylacetate catabolic process
External database links:  
ALPHAFOLD:
P77455
ECOCYC:
G6708-MONOMER
ECOLIWIKI:
b1387
INTERPRO:
IPR016161
INTERPRO:
IPR029069
INTERPRO:
IPR002539
INTERPRO:
IPR015590
INTERPRO:
IPR011966
INTERPRO:
IPR016163
INTERPRO:
IPR016162
MODBASE:
P77455
PDB:
6JQN
PDB:
6JQM
PDB:
6JQL
PDB:
6JQO
PFAM:
PF01575
PFAM:
PF00171
PRIDE:
P77455
PRODB:
PRO_000023164
PROSITE:
PS00070
REFSEQ:
NP_415905
SMR:
P77455
SWISSMODEL:
P77455
UNIPROT:
P77455


Operon      
Name: paaZ         
Operon arrangement:
Transcription unit        Promoter
paaZ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB