RegulonDB RegulonDB 10.9: Gene Form
   

paaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paaA paaC paaB

Gene      
Name: paaB    Texpresso search in the literature
Synonym(s): ECK1386, G6710, b1389, ynbF
Genome position(nucleotides): 1454868 --> 1455155 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.65
External database links:  
ASAP:
ABE-0004651
ECHOBASE:
EB4046
ECOLIHUB:
paaB
OU-MICROARRAY:
b1389
STRING:
511145.b1389
COLOMBOS: paaB


Product      
Name: phenylacetyl-CoA 1,2-epoxidase subunit B
Synonym(s): PaaB, YnbF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 10.942
Isoelectric point: 6.351
Motif(s):
 
Type Positions Sequence
6 -> 91 WPLYEVFVRGKQGLSHRHVGSLHAADERMALENARDAYTRRSEGCSIWVVKASEIVASQPEERGEFFDPAESKVYRHPTFYTIPDG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
biological_process GO:0010124 - phenylacetate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6710-MONOMER
ECOLIWIKI:
b1389
INTERPRO:
IPR009359
INTERPRO:
IPR038693
PFAM:
PF06243
PRIDE:
P76078
PRODB:
PRO_000023476
REFSEQ:
NP_415907
SMR:
P76078
UNIPROT:
P76078


Operon      
Name: paaABCDEFGHIJK         
Operon arrangement:
Transcription unit        Promoter
paaABCDEFGHIJK
paaJ
paaJ
paaJ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, SlyA, IHF
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB