RegulonDB RegulonDB 10.6.3: Gene Form
   

ynbA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydbD ynbC ynbB ynbA RcsB ynbAp ynbAp ynbAp5 ynbAp5 ynbAp3 ynbAp3

Gene      
Name: ynbA    Texpresso search in the literature
Synonym(s): ECK1401, G6727, b1408
Genome position(nucleotides): 1477621 --> 1478226 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.53
External database links:  
ASAP:
ABE-0004704
ECHOBASE:
EB3511
ECOCYC:
G6727
ECOLIHUB:
ynbA
OU-MICROARRAY:
b1408
REGULONDB:
b1408
STRING:
511145.b1408
M3D: ynbA
COLOMBOS: ynbA
PortEco: b1408


Product      
Name: inner membrane protein YnbA
Synonym(s): YnbA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 22.524
Isoelectric point: 8.331
Motif(s):
 
Type Positions Sequence
85 -> 107 LGAILNETGDVISDIALYLPFLF
117 -> 139 ILMLFCTILTEFCGLLAQTINGV
152 -> 172 ALIFGLWGLAVAIYPQWMQWN
27 -> 93 TANHITLAALALSLLTGLLLMLAAQPILFLLLPIVLFIRMALNALDGMLARECNQQTRLGAILNETG
44 -> 64 LLLMLAAQPILFLLLPIVLFI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
biological_process GO:0008654 - phospholipid biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6727-MONOMER
ECOLIWIKI:
b1408
INTERPRO:
IPR000462
PFAM:
PF01066
PRIDE:
P76090
PROTEINMODELPORTAL:
P76090
REFSEQ:
NP_415926
UNIPROT:
P76090


Operon      
Name: ynbABCD         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ynbAp3 1477462 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ynbAp5 1477471 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB