RegulonDB RegulonDB 10.6.3: Gene Form
   

ynbB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydbD ynbC ynbB ynbA RcsB ynbAp ynbAp ynbAp5 ynbAp5 ynbAp3 ynbAp3

Gene      
Name: ynbB    Texpresso search in the literature
Synonym(s): ECK1402, G6728, b1409
Genome position(nucleotides): 1478226 --> 1479122 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.59
External database links:  
ASAP:
ABE-0004706
ECHOBASE:
EB3512
ECOCYC:
G6728
ECOLIHUB:
ynbB
OU-MICROARRAY:
b1409
REGULONDB:
b1409
STRING:
511145.b1409
M3D: ynbB
COLOMBOS: ynbB
PortEco: b1409


Product      
Name: putative CDP-diglyceride synthase
Synonym(s): YnbB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.054
Isoelectric point: 9.268
Motif(s):
 
Type Positions Sequence
138 -> 158 IFWGWIMTVFALSHAAWLLML
38 -> 295 RIRTWWGIVICFSMVISGPRWMTLTFFALISFLALKEYCTLISVHFPRWLYWGIPLNYLLIGFNCFELFLLFIPLAGFLILATGQVLVGDPSGFLHTVSAIFWGWIMTVFALSHAAWLLMLPTTNIQGGALLVLFLLALTESNDIAQYLWGKSCGRRKVVPKVSPGKTLEGLMGGVITIMIASLIIGPLLTPLNTLQALLAGLLIGISGFCGDVVMSAIKRDIGVKDSGKLLPGHGGLLDRIDSLIFTAPVFFYFIRY
187 -> 187 W
273 -> 293 GGLLDRIDSLIFTAPVFFYFI
52 -> 72 VISGPRWMTLTFFALISFLAL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
biological_process GO:0009273 - peptidoglycan-based cell wall biogenesis
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-12743N
ECOCYC:
G6728-MONOMER
ECOLIWIKI:
b1409
INTERPRO:
IPR000374
PFAM:
PF01148
PRIDE:
P76091
PROSITE:
PS01315
PROTEINMODELPORTAL:
P76091
REFSEQ:
NP_415927
SMR:
P76091
UNIPROT:
P76091


Operon      
Name: ynbABCD         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ynbAp3 1477462 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ynbAp5 1477471 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB