RegulonDB RegulonDB 10.6.3: Gene Form
   

ynbC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynbC ynbD ynbB

Gene      
Name: ynbC    Texpresso search in the literature
Synonym(s): ECK1403, G6729, b1410
Genome position(nucleotides): 1479138 --> 1480895 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.91
External database links:  
ASAP:
ABE-0004708
ECHOBASE:
EB3513
ECOCYC:
G6729
ECOLIHUB:
ynbC
OU-MICROARRAY:
b1410
REGULONDB:
b1410
STRING:
511145.b1410
M3D: ynbC
COLOMBOS: ynbC
PortEco: b1410


Product      
Name: hydrolase/methyltransferase domain-containing protein YnbC
Synonym(s): YnbC
Sequence: Get amino acid sequence Fasta Format
Cellular location: membrane
Molecular weight: 65.456
Isoelectric point: 9.151
Motif(s):
 
Type Positions Sequence
32 -> 266 AKKVIVLFHRGHEHSGRLQHLVDELAMPDTAFYAWDARGHGKSSGPRGYSPSLARSVRDVDEFVRFAASDSQVGLEEVVVIAQSVGAVLVATWIHDYAPAIRGLVLASPAFKVKLYVPLARPALALWHRLRGLFFINSYVKGRYLTHDRQRGASFNNDPLITRAIAVNILLDLYKTSERIIRDAAAITLPTQLLISGDDYVVHRQPQIDFYQRLRSPLKELHLLPGFYHDTLGEE
275 -> 582 MQSFISRLYANKSQKFDYQHEDCTGPSADRWRLLSGGPVPLSPVDLAYRFMRKAMKLFGTHSSGLHLGMSTGFDSGSSLDYVYQNQPQGSNAFGRLVDKIYLNSVGWRGIRQRKTHLQILIKQAVADLHAKGLAVRVVDIAAGHGRYVLDALANEPAVSDILLRDYSELNVAQGQEMIAQRGMSGRVRFEQGDAFNPEELSALTPRPTLAIVSGLYELFPENEQVKNSLAGLANAIEPGGILIYTGQPWHPQLEMIAGVLTSHKDGKPWVMRVRSQGEMDSLVRDAGFDKCTQRIDEWGIFTVSMAVR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12744N
ECOCYC:
G6729-MONOMER
ECOLIWIKI:
b1410
INTERPRO:
IPR022744
INTERPRO:
IPR029063
INTERPRO:
IPR029058
INTERPRO:
IPR022742
MODBASE:
P76092
PFAM:
PF12147
PFAM:
PF12146
PRIDE:
P76092
PROTEINMODELPORTAL:
P76092
REFSEQ:
NP_415928
SMR:
P76092
UNIPROT:
P76092


Operon      
Name: ynbABCD         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB