RegulonDB RegulonDB 10.6.3: Gene Form
   

ynbD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynbC ynbD azoR TSS_1800 TSS_1800

Gene      
Name: ynbD    Texpresso search in the literature
Synonym(s): ECK1404, G6730, b1411
Genome position(nucleotides): 1480909 --> 1482201 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.58
External database links:  
ASAP:
ABE-0004710
ECHOBASE:
EB3514
ECOCYC:
G6730
ECOLIHUB:
ynbD
OU-MICROARRAY:
b1411
REGULONDB:
b1411
STRING:
511145.b1411
M3D: ynbD
COLOMBOS: ynbD
PortEco: b1411


Product      
Name: phosphatase domain-containing protein YnbD
Synonym(s): YnbD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 49.563
Isoelectric point: 8.697
Motif(s):
 
Type Positions Sequence
175 -> 195 HFIDVITGLAVGMLIDWMVPV
372 -> 392 VLVHCALGLSRSALVVAAWLL
85 -> 105 ILATVMACCGFLLYPLKFSFI
209 -> 229 IKIALPYVVGAGSCIVLMELM
306 -> 429 VYLGAFPRHIPAQNAVLDVTFEFPRGRATKDRLYFCVPMLDLVVPEEGELRQAVAMLETLREEQGSVLVHCALGLSRSALVVAAWLLCYGHCKTVNEAISYIRARRPQIVLTDEHKAMLRLWEN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0004725 - protein tyrosine phosphatase activity
GO:0016791 - phosphatase activity
GO:0008138 - protein tyrosine/serine/threonine phosphatase activity
biological_process GO:0006470 - protein dephosphorylation
GO:0016311 - dephosphorylation
GO:0035335 - peptidyl-tyrosine dephosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12745N
ECOCYC:
G6730-MONOMER
ECOLIWIKI:
b1411
INTERPRO:
IPR003595
INTERPRO:
IPR029021
INTERPRO:
IPR024950
INTERPRO:
IPR020422
INTERPRO:
IPR016130
INTERPRO:
IPR000387
INTERPRO:
IPR000340
MINT:
MINT-1248050
MODBASE:
P76093
PANTHER:
PTHR10159
PFAM:
PF00782
PRIDE:
P76093
PROSITE:
PS00383
PROSITE:
PS50056
PROTEINMODELPORTAL:
P76093
REFSEQ:
NP_415929
SMART:
SM00404
SMART:
SM00195
SMR:
P76093
UNIPROT:
P76093


Operon      
Name: ynbABCD         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1800 1482829 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB