RegulonDB RegulonDB 10.8: Gene Form
   

ydcL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insQ ydcL tehB yncK tehA terminator anti-terminator anti-anti-terminator terminator TSS_1812 TSS_1812 ydcLp5 ydcLp5 ydcLp6 ydcLp6 ydcLp1 ydcLp1 ydcLp4 ydcLp4 ydcLp7 ydcLp7

Gene      
Name: ydcL    Texpresso search in the literature
Synonym(s): ECK1424, G6742, b1431
Genome position(nucleotides): 1502457 --> 1503125 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.69
External database links:  
ASAP:
ABE-0004775
ECHOBASE:
EB3518
OU-MICROARRAY:
b1431
PortEco:
ydcL
STRING:
511145.b1431
COLOMBOS: ydcL


Product      
Name: DUF3313 domain-containing lipoprotein YdcL
Synonym(s): YdcL
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 24.427
Isoelectric point: 8.609
Motif(s):
 
Type Positions Sequence
21 -> 222 CASKITQPDKYSGFLNNYSDLKETTSATGKPVLRWVDPSFDQSKYDSIVWNPITYYPVPKPSTQVGQKVLDKILNYTNTEMKEAIAQRKPLVTTAGPRSLIFRGAITGVDTSKEGLQFYEVVPVALVVAGTQMATGHRTMDTRLYFEGELIDAATNKPVIKVVRQGEGKDLNNESTPMAFENIKQVIDDMATDATMFDVNKK
1 -> 20 MRTTSFAKVAALCGLLALSG
30 -> 213 KYSGFLNNYSDLKETTSATGKPVLRWVDPSFDQSKYDSIVWNPITYYPVPKPSTQVGQKVLDKILNYTNTEMKEAIAQRKPLVTTAGPRSLIFRGAITGVDTSKEGLQFYEVVPVALVVAGTQMATGHRTMDTRLYFEGELIDAATNKPVIKVVRQGEGKDLNNESTPMAFENIKQVIDDMATD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47883N
ECOCYC:
G6742-MONOMER
ECOLIWIKI:
b1431
INTERPRO:
IPR021747
PFAM:
PF11769
PRIDE:
P64451
PROSITE:
PS51257
REFSEQ:
NP_415948
UNIPROT:
P64451


Operon      
Name: ydcL         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydcLp7 1502323 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydcLp4 1502345 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydcLp1 1502369 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydcLp6 1502445 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydcLp5 1502446 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1812 1503657 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB