RegulonDB RegulonDB 10.8: Gene Form
   

insQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydcO insQ ydcL yncK terminator TSS_1812 TSS_1812

Gene      
Name: insQ    Texpresso search in the literature
Synonym(s): ECK1426, G6743, b1432, ydcM
Genome position(nucleotides): 1503717 --> 1504865 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.87
External database links:  
ASAP:
ABE-0004778
ECHOBASE:
EB3519
OU-MICROARRAY:
b1432
PortEco:
ydcM
STRING:
511145.b1432
COLOMBOS: insQ


Product      
Name: putative insertion element transposase InsQ
Synonym(s): InsQ, YdcM
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 43.364
Isoelectric point: 10.965
Motif(s):
 
Type Positions Sequence
1 -> 28 MRRFAGACRFVFNRALARQNENHEAGNK
284 -> 351 WYEMRRQLAYKQLWRGGQVLAVPPAYTSQRCAYCGHTAKENRLSQSKFRCQVCGYTANADVNGARNIL
142 -> 255 SIQTESEVSTPVHPSASMVGLDAGVAKLATLSDGTVFEPVNSFQKNQKKLARLQRQLSRKVKFSNNWQKQKRKIQRLHSCIANIRRDYLHKVTTAVSKNHAMIVIEDLKVSNMS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
biological_process GO:0006310 - DNA recombination
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48268N
ECOCYC:
G6743-MONOMER
ECOLIWIKI:
b1432
INTERPRO:
IPR010095
INTERPRO:
IPR001959
INTERPRO:
IPR021027
PFAM:
PF01385
PFAM:
PF07282
PFAM:
PF12323
PRIDE:
P76102
REFSEQ:
NP_415949
SMR:
P76102
UNIPROT:
P76102


Operon      
Name: insQ         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1812 1503657 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB