RegulonDB RegulonDB 10.8: Gene Form
   

sutR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlhA ydcO sutR SutR SutR terminator anti-terminator anti-anti-terminator anti-anti-terminator anti-terminator terminator TSS_1813 TSS_1813 ydcPp2 ydcPp2 ydcNp5 ydcNp5 sutRp sutRp

Gene      
Name: sutR    Texpresso search in the literature
Synonym(s): ECK1428, G6745, b1434, ydcN
Genome position(nucleotides): 1506172 --> 1506708 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.35
External database links:  
ASAP:
ABE-0004783
ECHOBASE:
EB3520
OU-MICROARRAY:
b1434
PortEco:
ydcN
STRING:
511145.b1434
COLOMBOS: sutR


Product      
Name: DNA-binding transcriptional dual regulator SutR
Synonym(s): SutR, YdcN
Sequence: Get amino acid sequence Fasta Format
Regulator Family: HTH_3
Cellular location: cytosol
Molecular weight: 19.731
Isoelectric point: 6.135
Motif(s):
 
Type Positions Sequence
23 -> 42 LSRLAEATGVSKAMLGQIER
105 -> 171 QMASGAISESTPHEKGVIEHVVVIDGQLDLCVDGEWQTLNCGEGVRFAADVTHIYRNGGEQTVHFHS
12 -> 66 LKQLRQQRGWSLSRLAEATGVSKAMLGQIERNESSPTVATLWKIATGLNVPFSTF

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[APPHINH] Assay of protein purified to homogeneity from its native host
[IEP] Inferred from expression pattern
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Perez-Rueda E., et al., 2000
[3] Perez-Rueda E., et al., 2004
[4] Yamamoto K., et al., 2015
External database links:  
DIP:
DIP-11649N
ECOCYC:
G6745-MONOMER
ECOLIWIKI:
b1434
INTERPRO:
IPR001387
INTERPRO:
IPR014710
INTERPRO:
IPR013096
INTERPRO:
IPR010982
INTERPRO:
IPR011051
MODBASE:
P77626
PFAM:
PF01381
PFAM:
PF07883
PRIDE:
P77626
PROSITE:
PS50943
REFSEQ:
NP_415951
SMART:
SM00530
SMR:
P77626
UNIPROT:
P77626


Operon      
Name: sutR         
Operon arrangement:
Transcription unit        Promoter
sutR


Transcriptional Regulation      
Display Regulation             
Activated by: SutR
Repressed by: SutR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydcNp5 1506154 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter ydcPp2 1506754 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_1813 1506757 forward nd [RS-EPT-CBR] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [4] Yamamoto K., Nakano M., Ishihama A., 2015, Regulatory role of transcription factor SutR (YdcN) in sulfur utilization in Escherichia coli., Microbiology 161(Pt 1):99-111

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB