RegulonDB RegulonDB 10.8: Gene Form
   

yncJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlhA yncJ unknown hicA HicB CRP hicAp2 hicAp2 hicAp1 hicAp1 TSS_1814 TSS_1814

Gene      
Name: yncJ    Texpresso search in the literature
Synonym(s): ECK1430, G6747, b1436
Genome position(nucleotides): 1508834 <-- 1509064 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.92
External database links:  
ASAP:
ABE-0004789
ECHOBASE:
EB4047
OU-MICROARRAY:
b1436
PortEco:
yncJ
STRING:
511145.b1436
COLOMBOS: yncJ


Product      
Name: protein YncJ
Synonym(s): YncJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.709
Isoelectric point: 7.073
Motif(s):
 
Type Positions Sequence
1 -> 76 MFTKALSVVLLTCALFSGQLMAGHKGHEFVWVKNVDHQLRHEADSDELRAVAEESAEGLREHFYWQKSRKPEAGQR
23 -> 76 GHKGHEFVWVKNVDHQLRHEADSDELRAVAEESAEGLREHFYWQKSRKPEAGQR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6747-MONOMER
ECOLIWIKI:
b1436
INTERPRO:
IPR020117
PFAM:
PF10829
PRIDE:
P64459
PRODOM:
PD057831
REFSEQ:
NP_415953
SMR:
P64459
UNIPROT:
P64459


Operon      
Name: yncJ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1814 1509035 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB