RegulonDB RegulonDB 10.7: Gene Form
   

hicB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydcR hicB hicA unknown ydcRp ydcRp

Gene      
Name: hicB    Texpresso search in the literature
Synonym(s): ECK1432, G6749, b1438, ydcQ
Genome position(nucleotides): 1509508 --> 1509924 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.56
External database links:  
ASAP:
ABE-0004796
ECHOBASE:
EB3523
OU-MICROARRAY:
b1438
PORTECO:
hicB
REGULONDB:
b1438
STRING:
511145.b1438
M3D: hicB
COLOMBOS: hicB
PortEco: b1438


Product      
Name: antitoxin of the HicA-HicB toxin-antitoxin system / DNA-binding transcriptional repressor HicB
Synonym(s): HicB, YdcQ
Sequence: Get amino acid sequence Fasta Format
Regulator Family: HTH_3
Cellular location: cytosol
Molecular weight: 15.247
Isoelectric point: 4.736
Motif(s):
 
Type Positions Sequence
93 -> 112 QQELARRIGKPKQEITRLFN
88 -> 134 QSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELS
3 -> 67 YPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHD
82 -> 136 LLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLV

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006950 - response to stress
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Button JE., et al., 2007
[2] Jorgensen MG., et al., 2009
[3] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-48269N
ECOCYC:
G6749-MONOMER
ECOLIWIKI:
b1438
INTERPRO:
IPR031807
INTERPRO:
IPR010982
INTERPRO:
IPR001387
INTERPRO:
IPR035069
PFAM:
PF15919
PFAM:
PF01381
PRIDE:
P67697
PROSITE:
PS50943
PROTEINMODELPORTAL:
P67697
REFSEQ:
NP_415955
SMART:
SM00530
SMR:
P67697
UNIPROT:
P67697


Operon      
Name: hicAB         
Operon arrangement:
Transcription unit        Promoter
 
hicAB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: HicB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Button JE., Silhavy TJ., Ruiz N., 2007, A suppressor of cell death caused by the loss of sigmaE downregulates extracytoplasmic stress responses and outer membrane vesicle production in Escherichia coli., J Bacteriol 189(5):1523-30

 [2] Jorgensen MG., Pandey DP., Jaskolska M., Gerdes K., 2009, HicA of Escherichia coli defines a novel family of translation-independent mRNA interferases in bacteria and archaea., J Bacteriol 191(4):1191-9

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB