RegulonDB RegulonDB 10.8: Gene Form
   

ydcT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydcS ydcT ydcU ydcV

Gene      
Name: ydcT    Texpresso search in the literature
Synonym(s): ECK1435, G6752, b1441
Genome position(nucleotides): 1512817 --> 1513830 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.44
External database links:  
ASAP:
ABE-0004805
ECHOBASE:
EB3526
OU-MICROARRAY:
b1441
PortEco:
ydcT
STRING:
511145.b1441
COLOMBOS: ydcT


Product      
Name: putative ABC transporter ATP-binding protein YdcT
Synonym(s): YdcT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 37.041
Isoelectric point: 7.059
Motif(s):
 
Type Positions Sequence
5 -> 235 VEFDNVSRLYGDVRAVDGVSIAIKDGEFFSMLGPSGSGKTTCLRLIAGFEQLSGGAISIFGKPASNLPPWERDVNTVFQDYALFPHMSILDNVAYGLMVKGVNKKQRHAMAQEALEKVALGFVHQRKPSQLSGGQRQRVAIARALVNEPRVLLLDEPLGALDLKLREQMQLELKKLQQSLGITFIFVTHDQGEALSMSDRVAVFNNGRIEQVDSPRDLYMRPRTPFVAGFV
257 -> 331 ALRPEHIRLNTPGELQANGTIQAVQYQGAATRFELKLNGGEKLLVSQANMTGEELPATLTPGQQVMVSWSRDVMV
37 -> 44 GPSGSGKT
21 -> 162 DGVSIAIKDGEFFSMLGPSGSGKTTCLRLIAGFEQLSGGAISIFGKPASNLPPWERDVNTVFQDYALFPHMSILDNVAYGLMVKGVNKKQRHAMAQEALEKVALGFVHQRKPSQLSGGQRQRVAIARALVNEPRVLLLDEPL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
[2] Moussatova A., et al., 2008
External database links:  
ECOCYC:
YDCT-MONOMER
ECOLIWIKI:
b1441
INTERPRO:
IPR013611
INTERPRO:
IPR008995
INTERPRO:
IPR003593
INTERPRO:
IPR017871
INTERPRO:
IPR027417
INTERPRO:
IPR003439
MODBASE:
P77795
PFAM:
PF08402
PFAM:
PF00005
PRIDE:
P77795
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_415958
SMART:
SM00382
SMR:
P77795
SWISSMODEL:
P77795
UNIPROT:
P77795


Operon      
Name: ydcSTUV-patD         
Operon arrangement:
Transcription unit        Promoter
ydcSTUV-patD
ydcSTUV-patD
 


Transcriptional Regulation      
Display Regulation             
Activated by: Nac


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Moussatova A., Kandt C., O'Mara ML., Tieleman DP., 2008, ATP-binding cassette transporters in Escherichia coli., Biochim Biophys Acta 1778(9):1757-71


RegulonDB