RegulonDB RegulonDB 10.8: Gene Form
   

ydcU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

patD ydcT ydcU ydcV patDp4 patDp4 patDp3 patDp3

Gene      
Name: ydcU    Texpresso search in the literature
Synonym(s): ECK1436, G6753, b1442
Genome position(nucleotides): 1513831 --> 1514772 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.97
External database links:  
ASAP:
ABE-0004807
ECHOBASE:
EB3527
OU-MICROARRAY:
b1442
PortEco:
ydcU
STRING:
511145.b1442
COLOMBOS: ydcU


Product      
Name: putative ABC transporter membrane subunit YdcU
Synonym(s): YdcU
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 34.36
Isoelectric point: 9.823
Motif(s):
 
Type Positions Sequence
87 -> 302 ILRTLTMAVAVTIASAILAFPMAWYMARYTSGKMKAFFYIAVMLPMWASYIVKAYAWTLLLAKDGVAQWFLQHLGLEPLLTAFLTLPAVGGNTLSTSGLGRFLVFLYIWLPFMILPVQAALERLPPSLLQASADLGARPRQTFRYVVLPLAIPGIAAGSIFTFSLTLGDFIVPQLVGPPGYFIGNMVYSQQGAIGNMPMAAAFTLVPIILIALYLA
188 -> 208 FLVFLYIWLPFMILPVQAALE
253 -> 273 LGDFIVPQLVGPPGYFIGNMV
123 -> 143 FFYIAVMLPMWASYIVKAYAW
155 -> 175 WFLQHLGLEPLLTAFLTLPAV

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
YDCU-MONOMER
ECOLIWIKI:
b1442
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P77156
PROSITE:
PS50928
REFSEQ:
NP_415959
UNIPROT:
P77156


Operon      
Name: ydcSTUV-patD         
Operon arrangement:
Transcription unit        Promoter
ydcSTUV-patD
ydcSTUV-patD
 


Transcriptional Regulation      
Display Regulation             
Activated by: Nac


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter patDp3 1515415 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter patDp4 1515440 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB