RegulonDB RegulonDB 10.8: Gene Form
   

curA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

curA mcbR mnaT ydcZ terminator mcbRp3 mcbRp3 TSS_1824 TSS_1824 yncBp4 yncBp4 TSS_1823 TSS_1823 TSS_1822 TSS_1822 TSS_1821 TSS_1821 TSS_1820 TSS_1820 TSS_1819 TSS_1819 ydcZp1 ydcZp1

Gene      
Name: curA    Texpresso search in the literature
Synonym(s): ECK1443, G6760, b1449, yncB
Genome position(nucleotides): 1519027 --> 1520064 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.31
Reference(s): [1] Hassaninasab A., et al., 2011
External database links:  
ASAP:
ABE-0004834
ECHOBASE:
EB3534
OU-MICROARRAY:
b1449
PortEco:
yncB
STRING:
511145.b1449
COLOMBOS: curA


Product      
Name: NADPH-dependent curcumin/dihydrocurcumin reductase
Synonym(s): CurA, YncB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.61
Isoelectric point: 5.614
Motif(s):
 
Type Positions Sequence
182 -> 186 GGAEK
247 -> 247 C
9 -> 115 RRWVLASRPHGAPVPENFRLEEDDVATPGEGQVLLRTVYLSLDPYMRGRMSDEPSYSPPVDIGGVMVGGTVSRVVESNHPDYQSGDWVLGYSGWQDYDISSGDDLVK
160 -> 163 GPVG
282 -> 284 FII

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-12748N
ECOCYC:
G6760-MONOMER
ECOLIWIKI:
b1449
INTERPRO:
IPR011032
INTERPRO:
IPR041694
INTERPRO:
IPR036291
INTERPRO:
IPR020843
INTERPRO:
IPR013149
MODBASE:
P76113
PANTHER:
PTHR11695
PFAM:
PF16884
PFAM:
PF00107
PRIDE:
P76113
REFSEQ:
NP_415966
SMART:
SM00829
SMR:
P76113
UNIPROT:
P76113


Operon      
Name: curA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydcZp1 1518375 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1819 1518403 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1820 1518461 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1821 1518476 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1822 1518862 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1823 1518873 reverse nd [RS-EPT-CBR] [3]
  promoter yncBp4 1518892 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1824 1518999 forward nd [RS-EPT-CBR] [3]
  promoter mcbRp3 1520096 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hassaninasab A., Hashimoto Y., Tomita-Yokotani K., Kobayashi M., 2011, Discovery of the curcumin metabolic pathway involving a unique enzyme in an intestinal microorganism., Proc Natl Acad Sci U S A 108(16):6615-20

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB