RegulonDB RegulonDB 10.8: Gene Form
   

mcbR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yncD curA mcbR terminator mcbRp3 mcbRp3

Gene      
Name: mcbR    Texpresso search in the literature
Synonym(s): ECK1444, G6761, b1450, yncC
Genome position(nucleotides): 1520262 --> 1520927 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.69
External database links:  
ASAP:
ABE-0004837
ECHOBASE:
EB3535
OU-MICROARRAY:
b1450
PortEco:
mcbR
STRING:
511145.b1450
COLOMBOS: mcbR


Product      
Name: DNA-binding transcriptional dual regulator McbR
Synonym(s): McbR, YncC
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GntR
Cellular location: cytosol
Molecular weight: 25.151
Isoelectric point: 6.883
Motif(s):
 
Type Positions Sequence
10 -> 77 VSLTLQVENDLKHQLSIGALKPGARLITKNLAEQLGMSITPVREALLRLVSVNALSVAPAQAFTVPEV
13 -> 74 TLQVENDLKHQLSIGALKPGARLITKNLAEQLGMSITPVREALLRLVSVNALSVAPAQAFTV
37 -> 56 TKNLAEQLGMSITPVREALL
85 -> 209 INRIRYELELMAVALAVENLTPQDLAELQELLEKLQQAQEKGDMEQIINVNRLFRLAIYHRSNMPILCEMIEQLWVRMGPGLHYLYEAINPAELREHIENYHLLLAALKAKDKEGCRHCLAEIMQ

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[APPHH] Assay of protein partially-purified from a heterologous host
[AUP] Assay of unpurified protein
[IEP] Inferred from expression pattern
Reference(s): [1] Beraud M., et al., 2010
[2] Perez-Rueda E., et al., 2004
[3] Zhang XS., et al., 2008
External database links:  
DIP:
DIP-12749N
ECOCYC:
G6761-MONOMER
ECOLIWIKI:
b1450
INTERPRO:
IPR000524
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR011711
INTERPRO:
IPR008920
MINT:
MINT-1303162
MODBASE:
P76114
PFAM:
PF00392
PFAM:
PF07729
PRIDE:
P76114
PRODB:
PRO_000023169
PROSITE:
PS50949
REFSEQ:
NP_415967
SMART:
SM00895
SMART:
SM00345
SMR:
P76114
UNIPROT:
P76114


Operon      
Name: mcbR         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mcbRp3 1520096 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Beraud M., Kolb A., Monteil V., D'Alayer J., Norel F., 2010, A proteomic analysis reveals differential regulation of the σ(S)-dependent yciGFE(katN) locus by YncC and H-NS in Salmonella and Escherichia coli K-12., Mol Cell Proteomics 9(12):2601-16

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Zhang XS., Garcia-Contreras R., Wood TK., 2008, Escherichia coli transcription factor YncC (McbR) regulates colanic acid and biofilm formation by repressing expression of periplasmic protein YbiM (McbA)., ISME J 2(6):615-31

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB