RegulonDB RegulonDB 10.8: Gene Form
   

nhoA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yddE nhoA yddH pptA TSS_1827 TSS_1827 nhoAp2 nhoAp2

Gene      
Name: nhoA    Texpresso search in the literature
Synonym(s): ECK1457, G6770, b1463, yddI
Genome position(nucleotides): 1534024 --> 1534869 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.42
External database links:  
ASAP:
ABE-0004882
ECHOBASE:
EB3542
OU-MICROARRAY:
b1463
PortEco:
nhoA
STRING:
511145.b1463
COLOMBOS: nhoA


Product      
Name: arylamine N-acetyltransferase
Synonym(s): NhoA, YddI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.275
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
22 -> 256 IDTLRALHLKHNCTIPFENLDVLLPREIQLDNQSPEEKLVIARRGGYCFEQNGVFERVLRELGFNVRSLLGRVVLSNPPALPPRTHRLLLVELEEEKWIADVGFGGQTLTAPIRLVSDLVQTTPHGEYRLLQEGDDWVLQFNHHQHWQSMYRFDLCEQQQSDYVMGNFWSAHWPQSHFRHHLLMCRHLPDGGKLTLTNFHFTHYENGHAVEQRNLPDVASLYAVMQEQFGLGVDD
281 -> 281 K
127 -> 127 G
214 -> 214 K

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016407 - acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0046990 - N-hydroxyarylamine O-acetyltransferase activity
GO:0004060 - arylamine N-acetyltransferase activity
GO:0042803 - protein homodimerization activity
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6770-MONOMER
ECOLIWIKI:
b1463
INTERPRO:
IPR038765
INTERPRO:
IPR001447
MODBASE:
P77567
PANTHER:
PTHR11786
PFAM:
PF00797
PRIDE:
P77567
PRINTS:
PR01543
PRODB:
PRO_000023382
REFSEQ:
NP_415980
SMR:
P77567
SWISSMODEL:
P77567
UNIPROT:
P77567


Operon      
Name: nhoA         
Operon arrangement:
Transcription unit        Promoter
nhoA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter nhoAp2 1533963 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1827 1534000 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB