RegulonDB RegulonDB 10.8: Gene Form
   

yddL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yddK yddG yddL terminator yddJp1 yddJp1 yddJp6 yddJp6 yddJp5 yddJp5 yddJp9 yddJp9 yddJp8 yddJp8

Gene      
Name: yddL    Texpresso search in the literature
Synonym(s): ECK1466, G6773, b1472
Genome position(nucleotides): 1545738 <-- 1546028 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.92
External database links:  
ASAP:
ABE-0004910
ECHOBASE:
EB3545
ECOO157CYC:
Z3057
ECOO157CYC:
Z2333
OU-MICROARRAY:
b1472
PortEco:
yddL
STRING:
316407.1742405
COLOMBOS: yddL


Product      
Name: putative uncharacterized protein YddL
Synonym(s): YddL, putative truncated Porin_1 family protein YddL
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 10.736
Isoelectric point: 7.658
Motif(s):
 
Type Positions Sequence
22 -> 96 AEVYNKDGNKLDLYGKVTALRYFTDDKRDDGDKTYARLGFKGETQINDQMIGFGHWEYDFKGYNDEANGSRGKNL
1 -> 21 MKLKIVAVVVTGLLAANVAHA
27 -> 91 KDGNKLDLYGKVTALRYFTDDKRDDGDKTYARLGFKGETQINDQMIGFGHWEYDFKGYNDEANGS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
molecular_function GO:0015288 - porin activity
biological_process GO:0034220 - ion transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6773-MONOMER
ECOLIWIKI:
b1472
ECOO157CYC:
Z3057-MONOMER
ECOO157CYC:
Z2333-MONOMER
INTERPRO:
IPR023614
INTERPRO:
IPR001897
INTERPRO:
IPR001702
MODBASE:
P77519
PFAM:
PF00267
PRIDE:
P77519
PRINTS:
PR00183
REFSEQ:
NP_415989
SMR:
P77519
SWISSMODEL:
P77519
UNIPROT:
P77519


Operon      
Name: yddLKJ         
Operon arrangement:
Transcription unit        Promoter
 


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yddJp8 1544758 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yddJp9 1544763 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yddJp5 1544825 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yddJp6 1544851 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yddJp1 1544866 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB