RegulonDB RegulonDB 10.8: Gene Form
   

bdm gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

osmC bdm sra RcsB NhaR Lrp RcsB ppGpp terminator osmCp2 osmCp2 TSS_1833 TSS_1833 osmCp1 osmCp1 bdmp bdmp srap srap

Gene      
Name: bdm    Texpresso search in the literature
Synonym(s): ECK1475, G6776, b1481, yddX
Genome position(nucleotides): 1556065 <-- 1556280 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.37
External database links:  
ASAP:
ABE-0004938
ECHOBASE:
EB4048
ECOL199310CYC:
C1914
OU-MICROARRAY:
b1481
PortEco:
bdm
STRING:
511145.b1481
COLOMBOS: bdm


Product      
Name: biofilm-dependent modulation protein
Synonym(s): Bdm, YddX, f92
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.987
Isoelectric point: 3.821
Motif(s):
 
Type Positions Sequence
1 -> 71 MFTYYQAENSTAEPALVNAIEQGLRAQHGVVTEDDILMELTKWVEASDNDILSDIYQQTINYVVSGQHPTL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
biological_process GO:1902210 - positive regulation of bacterial-type flagellum assembly
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Hersch SJ., et al., 2020
[2] Kim JS., et al., 2015
[3] Kim K., et al., 2011
External database links:  
ECOCYC:
G6776-MONOMER
ECOLIWIKI:
b1481
INTERPRO:
IPR019625
PFAM:
PF10684
PRIDE:
P76127
PRODB:
PRO_000022206
REFSEQ:
NP_415998
UNIPROT:
P76127


Operon      
Name: bdm-sra         
Operon arrangement:
Transcription unit        Promoter
sra
bdm-sra


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1833 1556600 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hersch SJ., Watanabe N., Stietz MS., Manera K., Kamal F., Burkinshaw B., Lam L., Pun A., Li M., Savchenko A., Dong TG., 2020, Envelope stress responses defend against type six secretion system attacks independently of immunity proteins., Nat Microbiol

 [2] Kim JS., Kim YJ., Seo S., Seong MJ., Lee K., 2015, Functional role of bdm during flagella biogenesis in Escherichia coli., Curr Microbiol 70(3):369-73

 [3] Kim K., Sim SH., Jeon CO., Lee Y., Lee K., 2011, Base substitutions at scissile bond sites are sufficient to alter RNA-binding and cleavage activity of RNase III., FEMS Microbiol Lett 315(1):30-7

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB