RegulonDB RegulonDB 10.7: Gene Form
   

ddpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ddpA ddpB ddpX ddpC

Gene      
Name: ddpA    Texpresso search in the literature
Synonym(s): ECK1481, G6781, b1487, yddS
Genome position(nucleotides): 1560931 <-- 1562481 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.35
External database links:  
ASAP:
ABE-0004958
ECHOBASE:
EB3551
OU-MICROARRAY:
b1487
PORTECO:
ddpA
REGULONDB:
b1487
STRING:
511145.b1487
M3D: ddpA
COLOMBOS: ddpA
PortEco: b1487


Product      
Name: putative D,D-dipeptide ABC transporter periplasmic binding protein
Synonym(s): DdpA, YddS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 57.641
Isoelectric point: 6.707
Motif(s):
 
Type Positions Sequence
1 -> 25 MKRSISFRPTLLALVLATNFPVAHA
78 -> 432 VEGDLASSWKASDDQKEWTFTLKDNAKFADGTPVTAEAVKLSFERLLKIGQGPAEAFPKDLKIDAPDEHTVKFTLSQPFAPFLYTLANDGASIINPAVLKEHAADDARGFLAQNTAGSGPFMLKSWQKGQQLVLVPNPHYPGNKPNFKRVSVKIIGESASRRLQLSRGDIDIADALPVDQLNALKQENKVNVAEYPSLRVTYLYLNNSKAPLNQADLRRAISWSTDYQGMVNGILSGNGKQMRGPIPEGMWGYDATAMQYNHDETKAKAEWDKVTSKPTSLTFLYSDNDPNWEPIALATQSSLNKLGIIVKLEKLANATMRDRVGKGDYDIAIGNWSPDFADPYMFMNYWFESDK
26 -> 516 AVPKDMLVIGKAADPQTLDPAVTIDNNDWTVTYPSYQRLVQYKTDGDKGSTDVEGDLASSWKASDDQKEWTFTLKDNAKFADGTPVTAEAVKLSFERLLKIGQGPAEAFPKDLKIDAPDEHTVKFTLSQPFAPFLYTLANDGASIINPAVLKEHAADDARGFLAQNTAGSGPFMLKSWQKGQQLVLVPNPHYPGNKPNFKRVSVKIIGESASRRLQLSRGDIDIADALPVDQLNALKQENKVNVAEYPSLRVTYLYLNNSKAPLNQADLRRAISWSTDYQGMVNGILSGNGKQMRGPIPEGMWGYDATAMQYNHDETKAKAEWDKVTSKPTSLTFLYSDNDPNWEPIALATQSSLNKLGIIVKLEKLANATMRDRVGKGDYDIAIGNWSPDFADPYMFMNYWFESDKKGLPGNRSFYENSEVDKLLRNALATTDQTQRTRDYQQAQKIVIDDAAYVYLFQKNYQLAMNKEVKGFVFNPMLEQVFNINTMSK

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:1904680 - peptide transmembrane transporter activity
biological_process GO:0015031 - protein transport
GO:0015833 - peptide transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Zhang X., et al., 2011
External database links:  
DIP:
DIP-11672N
ECOCYC:
YDDS-MONOMER
ECOLIWIKI:
b1487
INTERPRO:
IPR000914
INTERPRO:
IPR023765
INTERPRO:
IPR039424
INTERPRO:
IPR030678
MODBASE:
P76128
PANTHER:
PTHR30290
PFAM:
PF00496
PRIDE:
P76128
PROSITE:
PS01040
PROTEINMODELPORTAL:
P76128
REFSEQ:
NP_416004
SMR:
P76128
UNIPROT:
P76128


Operon      
Name: ddpXABCDF         
Operon arrangement:
Transcription unit        Promoter
ddpXABCDF
ddpXABCDF
ddpXABCDF


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Zhang X., Zhang Y., Li Z., Xia Y., Ye Q., 2011, Continuous culture and proteomic analysis of Escherichia coli DH5α and its acetate-tolerant mutant DA19 under conditions of nitrogen source limitation., Bioprocess Biosyst Eng 34(2):179-87


RegulonDB