RegulonDB RegulonDB 10.7: Gene Form
   

ddpX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dosP ddpA ddpX NtrC NtrC ddpXp3 ddpXp3 ddpXp2 ddpXp2 ddpXp ddpXp

Gene      
Name: ddpX    Texpresso search in the literature
Synonym(s): ECK1482, G6782, b1488, vanX, yddT
Genome position(nucleotides): 1562495 <-- 1563076 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.92
External database links:  
ASAP:
ABE-0004960
ECHOBASE:
EB3552
OU-MICROARRAY:
b1488
PORTECO:
ddpX
REGULONDB:
b1488
STRING:
511145.b1488
M3D: ddpX
COLOMBOS: ddpX
PortEco: b1488


Product      
Name: D-alanyl-D-alanine dipeptidase
Synonym(s): DdpX, VanX, YddT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,periplasmic space
Molecular weight: 21.213
Isoelectric point: 4.927
Motif(s):
 
Type Positions Sequence
4 -> 186 TTELVDLAVIFPDLEIELKYACADNITGKAIYQQARCLLHKDAITALAKSISIAQLSGLQLVIYDAYRPQQAQAMLWQACPDPQYVVDVTVGSNHSRGTAIDLTLRDEHGNILDMGAGFDEMHERSHAYHPSVPPAAQRNRLLLNAIMTGGGFVGISSEWWHFELPQAASYPLLADQFSCFIS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.5 - other compounds
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0008237 - metallopeptidase activity
GO:0016805 - dipeptidase activity
GO:0009046 - zinc D-Ala-D-Ala carboxypeptidase activity
biological_process GO:0006508 - proteolysis
GO:0042594 - response to starvation
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9418N
ECOCYC:
G6782-MONOMER
ECOLIWIKI:
b1488
INTERPRO:
IPR000755
INTERPRO:
IPR009045
PFAM:
PF01427
PRIDE:
P77790
PRODB:
PRO_000022421
PROTEINMODELPORTAL:
P77790
REFSEQ:
NP_416005
SMR:
P77790
SWISSMODEL:
P77790
UNIPROT:
P77790


Operon      
Name: ddpXABCDF         
Operon arrangement:
Transcription unit        Promoter
ddpXABCDF
ddpXABCDF
ddpXABCDF


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB