RegulonDB RegulonDB 10.7: Gene Form
   

dosP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dosP dosC ddpX NtrC NtrC anti-anti-terminator anti-terminator terminator dosPp3 dosPp3 ddpXp3 ddpXp3 ddpXp2 ddpXp2 ddpXp ddpXp

Gene      
Name: dosP    Texpresso search in the literature
Synonym(s): ECK1483, G6783, b1489, dos, pdeO, yddU
Genome position(nucleotides): 1563334 <-- 1565733 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.21
External database links:  
ASAP:
ABE-0004963
ECHOBASE:
EB3553
ECOO157CYC:
Z2220
ECOO157CYC:
Z2221
OU-MICROARRAY:
b1489
PORTECO:
dosP
REGULONDB:
b1489
STRING:
511145.b1489
M3D: dosP
COLOMBOS: dosP
PortEco: b1489


Product      
Name: oxygen-sensing c-di-GMP phosphodiesterase DosP
Synonym(s): Dos, DosP, PdeO, YddU, c-di-GMP phosphodiesterase, heme-regulated
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 90.26
Isoelectric point: 5.245
Motif(s):
 
Type Positions Sequence
91 -> 91 L
582 -> 582 H
107 -> 107 L
149 -> 250 VIVLDPERHIVQCNRAFTEMFGYCISEASGMQPDTLLNIPEFPADNRIRLQQLLWKTARDQDEFLLLTRTGEKIWIKASISPVYDVLAHLQNLVMTFSDITE
377 -> 525 QFDPMTGLPNRNNLHNYLDDLVDKAVSPVVYLIGVDHIQDVIDSLGYAWADQALLEVVNRFREKLKPDQYLCRIEGTQFVLVSLENDVSNITQIADELRNVVSKPIMIDDKPFPLTLSIGISYDLGKNRDYLLSTAHNAMDYIRKNGGN

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0000287 - magnesium ion binding
GO:0020037 - heme binding
GO:0042803 - protein homodimerization activity
GO:0071111 - cyclic-guanylate-specific phosphodiesterase activity
GO:0019826 - oxygen sensor activity
biological_process GO:0050896 - response to stimulus
GO:0070482 - response to oxygen levels
External database links:  
ECOCYC:
G6783-MONOMER
ECOLIWIKI:
b1489
ECOO157CYC:
Z2220-MONOMER
ECOO157CYC:
Z2221-MONOMER
INTERPRO:
IPR012226
INTERPRO:
IPR001633
INTERPRO:
IPR001610
INTERPRO:
IPR035965
INTERPRO:
IPR029787
INTERPRO:
IPR000700
INTERPRO:
IPR000014
INTERPRO:
IPR000160
INTERPRO:
IPR035919
MODBASE:
P76129
PDB:
4HU4
PDB:
4HU3
PDB:
1VB6
PDB:
1V9Z
PDB:
1V9Y
PDB:
1S67
PDB:
1S66
PFAM:
PF13426
PFAM:
PF00990
PFAM:
PF00563
PRIDE:
P76129
PRODB:
PRO_000022470
PROSITE:
PS50887
PROSITE:
PS50883
PROSITE:
PS50113
PROSITE:
PS50112
PROTEINMODELPORTAL:
P76129
REFSEQ:
NP_416006
SMART:
SM00052
SMART:
SM00086
SMART:
SM00091
SMART:
SM00267
SMR:
P76129
UNIPROT:
P76129


Operon      
Name: dosCP         
Operon arrangement:
Transcription unit        Promoter
dosCP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter dosPp3 1565743 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB