RegulonDB RegulonDB 10.7: Gene Form
   

dosC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dosP dosC yddY anti-anti-terminator anti-terminator terminator dosPp3 dosPp3

Gene      
Name: dosC    Texpresso search in the literature
Synonym(s): ECK1484, G6784, b1490, dgcO, yddV
Genome position(nucleotides): 1565758 <-- 1567140 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.4
External database links:  
ASAP:
ABE-0004965
ECHOBASE:
EB3554
OU-MICROARRAY:
b1490
PORTECO:
dosC
REGULONDB:
b1490
STRING:
511145.b1490
M3D: dosC
COLOMBOS: dosC
PortEco: b1490


Product      
Name: diguanylate cyclase DosC
Synonym(s): DgcO, DosC, YddV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 53.178
Isoelectric point: 6.211
Motif(s):
 
Type Positions Sequence
27 -> 155 AAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAF
365 -> 365 R
368 -> 368 D
98 -> 98 H
376 -> 376 D

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0019825 - oxygen binding
GO:0020037 - heme binding
GO:0042803 - protein homodimerization activity
GO:0052621 - diguanylate cyclase activity
GO:0070025 - carbon monoxide binding
biological_process GO:0006950 - response to stress
GO:0043709 - cell adhesion involved in single-species biofilm formation
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
External database links:  
ECOCYC:
G6784-MONOMER
ECOLIWIKI:
b1490
INTERPRO:
IPR039435
INTERPRO:
IPR029787
INTERPRO:
IPR012292
INTERPRO:
IPR009050
INTERPRO:
IPR000160
PDB:
4ZVH
PDB:
4ZVG
PDB:
4ZVF
PDB:
4ZVE
PDB:
4ZVD
PDB:
4ZVC
PDB:
4ZVB
PDB:
4ZVA
PFAM:
PF00990
PRIDE:
P0AA89
PROSITE:
PS50887
PROTEINMODELPORTAL:
P0AA89
REFSEQ:
NP_416007
SMART:
SM00267
SMR:
P0AA89
UNIPROT:
P0AA89


Operon      
Name: dosCP         
Operon arrangement:
Transcription unit        Promoter
dosCP


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter dosPp3 1565743 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB