RegulonDB RegulonDB 10.8: Gene Form
   

yddW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gadC yddW yddY terminator yddWp6 yddWp6

Gene      
Name: yddW    Texpresso search in the literature
Synonym(s): ECK1485, G6785, b1491
Genome position(nucleotides): 1567504 <-- 1568823 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.35
External database links:  
ASAP:
ABE-0004970
ECHOBASE:
EB3555
OU-MICROARRAY:
b1491
PortEco:
yddW
STRING:
511145.b1491
COLOMBOS: yddW


Product      
Name: putative lipoprotein YddW
Synonym(s): YddW
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 49.574
Isoelectric point: 9.589
Motif(s):
 
Type Positions Sequence
55 -> 390 PMRGIWLATVSRLDWPPVSSVNISNPTSRARVQQQAMIDKLDHLQRLGINTVFFQVKPDGTALWPSKILPWSDLMTGKIGENPGYDPLQFMLDEAHKRGMKVHAWFNPYRVSVNTKPGTIRELNSTLSQQPASVYVQHRDWIRTSGDRFVLDPGIPEVQDWITSIVAEVVSRYPVDGVQFDDYFYTESPGSRLNDNETYRKYGGAFASKADWRRNNTQQLIAKVSHTIKSIKPGVEFGVSPAGVWRNRSHDPLGSDTRGAAAYDESYADTRRWVEQGLLDYIAPQIYWPFSRSAARYDVLAKWWADVVKPTRTRLYIGIAFYKVGEPSKIEPDWMI
1 -> 27 MDICSRNKKLTIRRPAILVALALLLCS
28 -> 439 CKSTPPESMVTPPAGSKPPATTQQSSQPMRGIWLATVSRLDWPPVSSVNISNPTSRARVQQQAMIDKLDHLQRLGINTVFFQVKPDGTALWPSKILPWSDLMTGKIGENPGYDPLQFMLDEAHKRGMKVHAWFNPYRVSVNTKPGTIRELNSTLSQQPASVYVQHRDWIRTSGDRFVLDPGIPEVQDWITSIVAEVVSRYPVDGVQFDDYFYTESPGSRLNDNETYRKYGGAFASKADWRRNNTQQLIAKVSHTIKSIKPGVEFGVSPAGVWRNRSHDPLGSDTRGAAAYDESYADTRRWVEQGLLDYIAPQIYWPFSRSAARYDVLAKWWADVVKPTRTRLYIGIAFYKVGEPSKIEPDWMINGGVPELKKQLDLNDAVPEISGTILFREDYLNKPQTQQAVSYLQSRWGS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0003824 - catalytic activity
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48187N
ECOCYC:
G6785-MONOMER
ECOLIWIKI:
b1491
INTERPRO:
IPR017853
INTERPRO:
IPR013785
INTERPRO:
IPR003790
MODBASE:
P64426
PFAM:
PF02638
PRIDE:
P64426
PROSITE:
PS51257
REFSEQ:
NP_416008
SMR:
P64426
UNIPROT:
P64426


Operon      
Name: yddW         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yddWp6 1568852 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB