RegulonDB RegulonDB 10.7: Gene Form
   

gadC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gadC gadB yddW Fis terminator terminator TSS_1834 TSS_1834 gadCp1 gadCp1 gadCp6 gadCp6 gadCp5 gadCp5 yddWp6 yddWp6

Gene      
Name: gadC    Texpresso search in the literature
Synonym(s): ECK1486, G6786, acsA, b1492, xasA
Genome position(nucleotides): 1568954 <-- 1570489 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.11
External database links:  
ASAP:
ABE-0004973
ECHOBASE:
EB2350
OU-MICROARRAY:
b1492
PORTECO:
gadC
REGULONDB:
b1492
STRING:
511145.b1492
M3D: gadC
COLOMBOS: gadC
PortEco: b1492


Product      
Name: L-glutamate:4-aminobutyrate antiporter
Synonym(s): AcsA, GadC, GadC GABA APC transporter, XasA, glutamic acid:gamma;-aminobutyrate antiporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 55.077
Isoelectric point: 8.902
Motif(s):
 
Type Positions Sequence
42 -> 62 LVFFLLLGGILWFIPVGLCAA
94 -> 114 FGYLQIAIGFIPMLYFVLGAL
292 -> 312 VISALLLLGVLAEIASWIVGP
158 -> 178 VGFFAGILLPAFILIALAAIY
13 -> 451 LTLLGFFAITASMVMAVYEYPTFATSGFSLVFFLLLGGILWFIPVGLCAAEMATVDGWEEGGVFAWVSNTLGPRWGFAAISFGYLQIAIGFIPMLYFVLGALSYILKWPALNEDPITKTIAALIILWALALTQFGGTKYTARIAKVGFFAGILLPAFILIALAAIYLHSGAPVAIEMDSKTFFPDFSKVGTLVVFVAFILSYMGVEASATHVNEMSNPGRDYPLAMLLLMVAAICLSSVGGLSIAMVIPGNEINLSAGVMQTFTVLMSHVAPEIEWTVRVISALLLLGVLAEIASWIVGPSRGMYVTAQKNLLPAAFAKMNKNGVPVTLVISQLVITSIALIILTNTGGGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKHPDLKRTFNIPGGKGVKLVVAIVGLLTSIMAFIVSFLPPDNIQGDSTDMYVELLVV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015297 - antiporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0051454 - intracellular pH elevation
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] De Biase D., et al., 1999
[2] Lin J., et al., 1995
[3] Tramonti A., et al., 2006
External database links:  
DIP:
DIP-48121N
ECOCYC:
XASA-MONOMER
ECOLIWIKI:
b1492
INTERPRO:
IPR002293
INTERPRO:
IPR004759
PANTHER:
PTHR11785
PDB:
4DJI
PDB:
4DJK
PFAM:
PF13520
PRIDE:
P63235
PROTEINMODELPORTAL:
P63235
REFSEQ:
NP_416009
SMR:
P63235
UNIPROT:
P63235


Operon      
Name: gadBC         
Operon arrangement:
Transcription unit        Promoter
gadBC
 


Transcriptional Regulation      
Display Regulation             
Activated by: GadX, GadW, AdiY, GadE, RcsB
Repressed by: CRP, FliZ, GadW, Fis


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yddWp6 1568852 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter gadCp5 1570527 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter gadCp6 1570577 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter gadCp1 1570584 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_1834 1571620 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] De Biase D., Tramonti A., Bossa F., Visca P., 1999, The response to stationary-phase stress conditions in Escherichia coli: role and regulation of the glutamic acid decarboxylase system., Mol Microbiol 32(6):1198-211

 [2] Lin J., Lee IS., Frey J., Slonczewski JL., Foster JW., 1995, Comparative analysis of extreme acid survival in Salmonella typhimurium, Shigella flexneri, and Escherichia coli., J Bacteriol 177(14):4097-104

 [3] Tramonti A., De Canio M., Delany I., Scarlato V., De Biase D., 2006, Mechanisms of transcription activation exerted by GadX and GadW at the gadA and gadBC gene promoters of the glutamate-based acid resistance system in Escherichia coli., J Bacteriol 188(23):8118-27

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB