RegulonDB RegulonDB 10.8: Gene Form
   

ydeM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yddA ydeN ydeM yneP terminator terminator yddBp6 yddBp6

Gene      
Name: ydeM    Texpresso search in the literature
Synonym(s): ECK1491, G6787, b1497
Genome position(nucleotides): 1579633 <-- 1580790 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.69
External database links:  
ASAP:
ABE-0004986
ECHOBASE:
EB3556
OU-MICROARRAY:
b1497
PortEco:
ydeM
STRING:
511145.b1497
COLOMBOS: ydeM


Product      
Name: putative anaerobic sulfatase maturation enzyme YdeM
Synonym(s): YdeM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.518
Isoelectric point: 8.024
Motif(s):
 
Type Positions Sequence
263 -> 318 CKDNLVVESNGDIYECDHFVYPQYKIGNINKSELKTMNSVQLTAQKKRIPAKCQQC
11 -> 175 QCNLKCDYCFYLEKESQFTHEKWMDDSTLKEFIKQYIAASGNQVYFTWQGGEPTLAGLDFFRKVIHYQQRYAGQKRIFNALQTNGILLNNEWCAFLKEHEFLVGISIDGPQELHDRYRRSNSGNGTFAKVIAAIERLKSYQVEFNTLTVINNVNVHYPLEVYHFL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0051604 - protein maturation
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[HIFS] Human inference of function from sequence
Reference(s): [1] Berteau O., et al., 2006
[2] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
G6787-MONOMER
ECOLIWIKI:
b1497
INTERPRO:
IPR023885
INTERPRO:
IPR034491
INTERPRO:
IPR013785
INTERPRO:
IPR007197
MODBASE:
P76134
PFAM:
PF13186
PFAM:
PF04055
PRIDE:
P76134
REFSEQ:
NP_416014
SMR:
P76134
UNIPROT:
P76134


Operon      
Name: ydeNM         
Operon arrangement:
Transcription unit        Promoter
ydeNM
 


Transcriptional Regulation      
Display Regulation             
Repressed by: NagC, GadX, AraC


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yddBp6 1577666 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Berteau O., Guillot A., Benjdia A., Rabot S., 2006, A new type of bacterial sulfatase reveals a novel maturation pathway in prokaryotes., J Biol Chem 281(32):22464-70

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB