RegulonDB RegulonDB 10.8: Gene Form
   

ydeN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydeN ydeM ydeO yneP GadX NagC GadX NagC terminator ydeNp3 ydeNp3 ydeNp ydeNp

Gene      
Name: ydeN    Texpresso search in the literature
Synonym(s): ECK1492, G6788, b1498
Genome position(nucleotides): 1580842 <-- 1582524 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.09
External database links:  
ASAP:
ABE-0004988
ECHOBASE:
EB3557
OU-MICROARRAY:
b1498
PortEco:
ydeN
STRING:
511145.b1498
COLOMBOS: ydeN


Product      
Name: putative sulfatase YdeN
Synonym(s): YdeN
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 62.802
Isoelectric point: 5.931
Motif(s):
 
Type Positions Sequence
58 -> 408 PNIIVLTMDDLGYGQLPFDKGSFDPKTMENREVVDTYKIGIDKAIEAAQKSTPTLLSLMDEGVRFTNGYVAHGVSGPSRAAIMTGRAPARFGVYSNTDAQDGIPLTETFLPELFQNHGYYTAAVGKWHLSKISNVPVPEDKQTRDYHDNFTTFSAEEWQPQNRGFDYFMGFHAAGTAYYNSPSLFKNRERVPAKGYISDQLTDEAIGVVDRAKTLDQPFMLYLAYNAPHLPNDNPAPDQYQKQFNTGSQTADNYYASVYSVDQGVKRILEQLKKNGQYDNTIILFTSDNGAVIDGPLPLNGAQKGYKSQTYPGGTHTPMFMWWKGKLQPGNYDKLISAMDFYPTALDAADI
1 -> 29 MKSALKKSVVSTSISLILASGMAAFAAHA
30 -> 560 ADDVKLKATKTNVAFSDFTPTEYSTKGKPNIIVLTMDDLGYGQLPFDKGSFDPKTMENREVVDTYKIGIDKAIEAAQKSTPTLLSLMDEGVRFTNGYVAHGVSGPSRAAIMTGRAPARFGVYSNTDAQDGIPLTETFLPELFQNHGYYTAAVGKWHLSKISNVPVPEDKQTRDYHDNFTTFSAEEWQPQNRGFDYFMGFHAAGTAYYNSPSLFKNRERVPAKGYISDQLTDEAIGVVDRAKTLDQPFMLYLAYNAPHLPNDNPAPDQYQKQFNTGSQTADNYYASVYSVDQGVKRILEQLKKNGQYDNTIILFTSDNGAVIDGPLPLNGAQKGYKSQTYPGGTHTPMFMWWKGKLQPGNYDKLISAMDFYPTALDAADISIPKDLKLDGVSLLPWLQDKKQGEPHKNLTWITSYSHWFDEENIPFWDNYHKFVRHQSDDYPHNPNTEDLSQFSYTVRNNDYSLVYTVENNQLGLYKLTDLQQKDNLAAANPQVVKEMQGVVREFIDSSQPPLSEVNQEKFNNIKKALSEAK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004065 - arylsulfatase activity
GO:0008484 - sulfuric ester hydrolase activity
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11682N
ECOCYC:
G6788-MONOMER
ECOLIWIKI:
b1498
INTERPRO:
IPR024607
INTERPRO:
IPR017850
INTERPRO:
IPR000917
MODBASE:
P77318
PFAM:
PF00884
PRIDE:
P77318
PROSITE:
PS00149
PROSITE:
PS00523
REFSEQ:
NP_416015
SMR:
P77318
UNIPROT:
P77318


Operon      
Name: ydeNM         
Operon arrangement:
Transcription unit        Promoter
ydeNM
 


Transcriptional Regulation      
Display Regulation             
Repressed by: NagC, GadX, AraC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydeNp3 1582729 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB