RegulonDB RegulonDB 10.9: Gene Form
   

safA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydeP ydeO safA EvgA PhoP PhoP safAp safAp

Gene      
Name: safA    Texpresso search in the literature
Synonym(s): ECK4475, G6790, b1500, yneN
Genome position(nucleotides): 1583762 <-- 1583959 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
37.37
External database links:  
ASAP:
ABE-0004994
ECOLIHUB:
yneN
OU-MICROARRAY:
b1500
STRING:
511145.b1500
COLOMBOS: safA


Product      
Name: two-component system connector SafA
Synonym(s): SafA, YneN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.272
Isoelectric point: 9.224
Motif(s):
 
Type Positions Sequence
19 -> 39 IMSAIVVVLLLTLTLIAIFSA
1 -> 64 MHATTVKNKITQRDNYKEIMSAIVVVLLLTLTLIAIFSAIDQLSISEMGRIARDLTHFIINSLQ

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0030295 - protein kinase activator activity
biological_process GO:0010447 - response to acidic pH
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IPI] Inferred from physical interaction
Reference(s): [1] Eguchi Y., et al., 2011
[2] Eguchi Y., et al., 2007
[3] Herzberg M., et al., 2006
External database links:  
DIP:
DIP-46181N
ECOCYC:
MONOMER0-2841
ECOLIWIKI:
b1500
INTERPRO:
IPR031411
PFAM:
PF17073
PRIDE:
P76136
REFSEQ:
NP_416017
UNIPROT:
P76136


Operon      
Name: safA-ydeO         
Operon arrangement:
Transcription unit        Promoter
safA-ydeO
ydeO


Transcriptional Regulation      
Display Regulation             
Activated by: EvgA, RcsB
Repressed by: PhoP, YdeO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Eguchi Y., Ishii E., Hata K., Utsumi R., 2011, Regulation of acid resistance by connectors of two-component signal transduction systems in Escherichia coli., J Bacteriol 193(5):1222-8

 [2] Eguchi Y., Itou J., Yamane M., Demizu R., Yamato F., Okada A., Mori H., Kato A., Utsumi R., 2007, B1500, a small membrane protein, connects the two-component systems EvgS/EvgA and PhoQ/PhoP in Escherichia coli., Proc Natl Acad Sci U S A 104(47):18712-7

 [3] Herzberg M., Kaye IK., Peti W., Wood TK., 2006, YdgG (TqsA) controls biofilm formation in Escherichia coli K-12 through autoinducer 2 transport., J Bacteriol 188(2):587-98


RegulonDB