RegulonDB RegulonDB 10.8: Gene Form
   

ydeR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydeQ ydeS ydeR ydeRp1 ydeRp1

Gene      
Name: ydeR    Texpresso search in the literature
Synonym(s): ECK1496, G6793, b1503
Genome position(nucleotides): 1587793 <-- 1588296 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.84
External database links:  
ASAP:
ABE-0005008
ECHOBASE:
EB3561
OU-MICROARRAY:
b1503
PortEco:
ydeR
STRING:
511145.b1503
COLOMBOS: ydeR


Product      
Name: putative fimbrial protein YdeR
Synonym(s): YdeR
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 18.144
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
1 -> 23 MKRLHKRFLLATFCALFTATLQA
24 -> 167 ADVTITVNGRVVAKPCTIQTKEANVNLGDLYTRNLQQPGSASGWHNITLSLTDCPVETSAVTAIVTGSTDNTGYYKNEGTAENIQIELRDDQDAALKNGDSKTVIVDEITRNAQFPLKARAITVNGNASQGTIEALINVIYTWQ
29 -> 163 TVNGRVVAKPCTIQTKEANVNLGDLYTRNLQQPGSASGWHNITLSLTDCPVETSAVTAIVTGSTDNTGYYKNEGTAENIQIELRDDQDAALKNGDSKTVIVDEITRNAQFPLKARAITVNGNASQGTIEALINVI

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11685N
ECOCYC:
G6793-MONOMER
ECOLIWIKI:
b1503
INTERPRO:
IPR008966
INTERPRO:
IPR000259
INTERPRO:
IPR036937
MODBASE:
P77294
PFAM:
PF00419
PRIDE:
P77294
REFSEQ:
NP_416020
SMR:
P77294
UNIPROT:
P77294


Operon      
Name: ydeTSR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydeRp1 1588298 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB