RegulonDB RegulonDB 10.8: Gene Form
   

yneL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yneL    Texpresso search in the literature
Synonym(s): ECK1499, G6796, b1506
Type: Pseudo Gene
Genome position(nucleotides): 1590334 <-- 1590536 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.31
External database links:  
ASAP:
ABE-0005019
ECHOBASE:
EB4106
OU-MICROARRAY:
b1506
PortEco:
yneL
STRING:
316407.85674996
COLOMBOS: yneL


Product      
Name: putative HTH-type transcriptional regulator YneL
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
1 -> 59 MSPLRYQKWLRLNEVRRQMLNEHYDVTTAAYAVGYESYPISVGNIRGCLESHPREILPG
26 -> 49 VTTAAYAVGYESYPISVGNIRGCL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] DeLisa MP., et al., 2001
[2] Spiteri D., et al., 2017
External database links:  
ECOCYC:
G6796-MONOMER
ECOLIWIKI:
b1506
INTERPRO:
IPR018060
PRIDE:
P76138
PROSITE:
PS01124
REFSEQ:
NP_416023
SMR:
P76138
UNIPROT:
P76138


Operon      
Name: yneL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1836 1592159 reverse nd [RS-EPT-CBR] [3]



RegulonDB