RegulonDB RegulonDB 10.7: Gene Form
   

lsrR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lsrK lsrA lsrR lsrC LsrR CRP CRP LsrR lsrAp lsrAp lsrRp lsrRp

Gene      
Name: lsrR    Texpresso search in the literature
Synonym(s): ECK1505, G6799, b1512, ydeW
Genome position(nucleotides): 1600288 <-- 1601241 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.73
External database links:  
ASAP:
ABE-0005045
ECHOBASE:
EB3566
OU-MICROARRAY:
b1512
PORTECO:
lsrR
REGULONDB:
b1512
STRING:
511145.b1512
M3D: lsrR
COLOMBOS: lsrR
PortEco: b1512


Product      
Name: DNA-binding transcriptional repressor LsrR
Synonym(s): LsrR, YdeW
Sequence: Get amino acid sequence Fasta Format
Regulator Family: Sugar_binding domain
Cellular location: cytosol
Molecular weight: 33.797
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence
33 -> 52 QSEISDRLGLTRLKVSRLLE
67 -> 315 RFEGCLEYETQLRRQFSLQHVRVIPGLADADVGGRLGIGAAHMLMSLLQPQQMLAIGFGEATMNTLQRLSGFISSQQIRLVTLSGGVGSYMTGIGQLNAACSVNIIPAPLRASSADIARTLKNENCVKDVLLAAQAADVAIVGIGAVSQQDDATIIRSGYISQGEQLMIGRKGAVGDILGYFFDAKGDVVTNIKIHNELIGLPLSALKTIPVRVGVAGGENKAEAIAAAMKGGYINALVTDQDTAAAIL
239 -> 317 GAVGDILGYFFDAKGDVVTNIKIHNELIGLPLSALKTIPVRVGVAGGENKAEAIAAAMKGGYINALVTDQDTAAAILRS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0030246 - carbohydrate binding
GO:0042802 - identical protein binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0009408 - response to heat
GO:2000142 - regulation of DNA-templated transcription, initiation
External database links:  
DIP:
DIP-11688N
ECOCYC:
G6799-MONOMER
ECOLIWIKI:
b1512
INTERPRO:
IPR037171
INTERPRO:
IPR036388
INTERPRO:
IPR007324
MODBASE:
P76141
PDB:
4L5J
PDB:
4L5I
PDB:
4L51
PDB:
4L50
PDB:
4L4Z
PDB:
4L4Y
PDB:
4GO1
PFAM:
PF04198
PRIDE:
P76141
PRODB:
PRO_000023134
PROTEINMODELPORTAL:
P76141
REFSEQ:
NP_416029
SMR:
P76141
UNIPROT:
P76141


Operon      
Name: lsrRK         
Operon arrangement:
Transcription unit        Promoter
lsrRK
lsrK


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: LsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB