RegulonDB RegulonDB 10.7: Gene Form
   

lsrF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lsrB lsrF lsrG terminator anti-terminator anti-anti-terminator tamp tamp

Gene      
Name: lsrF    Texpresso search in the literature
Synonym(s): ECK1510, G6804, b1517, yneB
Genome position(nucleotides): 1606100 --> 1606975 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.66
External database links:  
ASAP:
ABE-0005065
ECHOBASE:
EB3571
OU-MICROARRAY:
b1517
PORTECO:
lsrF
REGULONDB:
b1517
STRING:
511145.b1517
M3D: lsrF
COLOMBOS: lsrF
PortEco: b1517


Product      
Name: 3-hydroxy-2,4-pentadione 5-phosphate thiolase
Synonym(s): LsrF, YneB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.893
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
57 -> 57 D
203 -> 203 K
251 -> 251 D
52 -> 258 VMLAFDHGYFQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNRPVVLRASGANSILAELSNEAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAGMKVGMPTMAVTGVGKDMVRDQRYFSLATRIAAEMGAQIIKTYYVEKGFERIVAGCPVPIVIAGGKKLPEREALEMCWQAIDQGASGVDMGRNIFQ

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016829 - lyase activity
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
GO:0016832 - aldehyde-lyase activity
GO:0004332 - fructose-bisphosphate aldolase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Brito PH., et al., 2013
[2] Pereira CS., et al., 2012
[3] Quan DN., et al., 2012
External database links:  
DIP:
DIP-12754N
ECOCYC:
G6804-MONOMER
ECOLIWIKI:
b1517
INTERPRO:
IPR041720
INTERPRO:
IPR033673
INTERPRO:
IPR002915
INTERPRO:
IPR013785
MODBASE:
P76143
PDB:
4P2V
PDB:
3GND
PDB:
3GLC
PDB:
3GKF
PFAM:
PF01791
PRIDE:
P76143
PROTEINMODELPORTAL:
P76143
REFSEQ:
NP_416034
SMART:
SM01133
SMR:
P76143
UNIPROT:
P76143


Operon      
Name: lsrACDBFG-tam         
Operon arrangement:
Transcription unit        Promoter
lsrACDBFG-tam
tam


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: LsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Brito PH., Rocha EP., Xavier KB., Gordo I., 2013, Natural genome diversity of AI-2 quorum sensing in Escherichia coli: conserved signal production but labile signal reception., Genome Biol Evol 5(1):16-30

 [2] Pereira CS., Santos AJ., Bejerano-Sagie M., Correia PB., Marques JC., Xavier KB., 2012, Phosphoenolpyruvate phosphotransferase system regulates detection and processing of the quorum sensing signal autoinducer-2., Mol Microbiol 84(1):93-104

 [3] Quan DN., Bentley WE., 2012, Gene network homology in prokaryotes using a similarity search approach: queries of quorum sensing signal transduction., PLoS Comput Biol 8(8):e1002637


RegulonDB