RegulonDB RegulonDB 10.7: Gene Form
   

lsrG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lsrF tam lsrG terminator anti-terminator anti-anti-terminator tamp tamp

Gene      
Name: lsrG    Texpresso search in the literature
Synonym(s): ECK1511, G6805, b1518, yneC
Genome position(nucleotides): 1606999 --> 1607289 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.39
External database links:  
ASAP:
ABE-0005067
ECHOBASE:
EB3572
OU-MICROARRAY:
b1518
PORTECO:
lsrG
REGULONDB:
b1518
STRING:
511145.b1518
M3D: lsrG
COLOMBOS: lsrG
PortEco: b1518


Product      
Name: (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase
Synonym(s): LsrG, YneC, phospho-AI-2 isomerase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.255
Isoelectric point: 5.982
Motif(s):
 
Type Positions Sequence
65 -> 65 H
25 -> 25 N
54 -> 54 E
70 -> 70 H
1 -> 76 MHVTLVEINVHEDKVDEFIEVFRQNHLGSVQEEGNLRFDVLQDPEVNSRFYIYEAYKDEDAVAFHKTTPHYKTCVA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0002952 - (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase activity
GO:0016853 - isomerase activity
GO:0016491 - oxidoreductase activity
GO:0016861 - intramolecular oxidoreductase activity, interconverting aldoses and ketoses
biological_process GO:0009372 - quorum sensing
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Brito PH., et al., 2013
[2] Pereira CS., et al., 2012
[3] Quan DN., et al., 2012
External database links:  
DIP:
DIP-47853N
ECOCYC:
G6805-MONOMER
ECOLIWIKI:
b1518
INTERPRO:
IPR007138
INTERPRO:
IPR033672
INTERPRO:
IPR011008
MODBASE:
P64461
PDB:
3QMQ
PFAM:
PF03992
PRIDE:
P64461
PRODB:
PRO_000023132
PROSITE:
PS51725
PROTEINMODELPORTAL:
P64461
REFSEQ:
NP_416035
SMR:
P64461
UNIPROT:
P64461


Operon      
Name: lsrACDBFG-tam         
Operon arrangement:
Transcription unit        Promoter
lsrACDBFG-tam
tam


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: LsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Brito PH., Rocha EP., Xavier KB., Gordo I., 2013, Natural genome diversity of AI-2 quorum sensing in Escherichia coli: conserved signal production but labile signal reception., Genome Biol Evol 5(1):16-30

 [2] Pereira CS., Santos AJ., Bejerano-Sagie M., Correia PB., Marques JC., Xavier KB., 2012, Phosphoenolpyruvate phosphotransferase system regulates detection and processing of the quorum sensing signal autoinducer-2., Mol Microbiol 84(1):93-104

 [3] Quan DN., Bentley WE., 2012, Gene network homology in prokaryotes using a similarity search approach: queries of quorum sensing signal transduction., PLoS Comput Biol 8(8):e1002637


RegulonDB