RegulonDB RegulonDB 10.7: Gene Form
   

yneG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sad dgcF glsB yneG terminator TSS_1838 TSS_1838 yneFp7 yneFp7 TSS_1837 TSS_1837

Gene      
Name: yneG    Texpresso search in the literature
Synonym(s): ECK1516, G6809, b1523
Genome position(nucleotides): 1611966 <-- 1612325 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.78
External database links:  
ASAP:
ABE-0005084
ECHOBASE:
EB3576
OU-MICROARRAY:
b1523
PORTECO:
yneG
REGULONDB:
b1523
STRING:
511145.b1523
M3D: yneG
COLOMBOS: yneG
PortEco: b1523


Product      
Name: DUF4186 domain-containing protein YneG
Synonym(s): YneG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.544
Isoelectric point: 10.248
Motif(s):
 
Type Positions Sequence
7 -> 112 LFARLSRSKFRSRFRLGMKERQYCLEKGAPVIEQHAADFVAKRLAPALPANDGKQTPMRGHPVFIAQHATATCCRGCLAKWHNIPQGVSLSEEQQRYIVAVIYHWL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12756N
ECOCYC:
G6809-MONOMER
ECOLIWIKI:
b1523
INTERPRO:
IPR020378
PFAM:
PF13811
PRIDE:
P76148
PRODOM:
PD076485
PROTEINMODELPORTAL:
P76148
REFSEQ:
NP_416040
UNIPROT:
P76148


Operon      
Name: glsB-yneG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1837 1611861 reverse nd [RS-EPT-CBR] [1]
  promoter yneFp7 1611874 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1838 1611884 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB