RegulonDB RegulonDB 10.8: Gene Form
   

glsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: glsB    Texpresso search in the literature
Synonym(s): ECK1517, G6810, b1524, yneH
Genome position(nucleotides): 1612325 <-- 1613251 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.0
External database links:  
ASAP:
ABE-0005086
ECHOBASE:
EB3577
OU-MICROARRAY:
b1524
PortEco:
yneH
STRING:
511145.b1524
COLOMBOS: glsB


Product      
Name: glutaminase 2
Synonym(s): GlsB, YneH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 33.516
Isoelectric point: 6.402
Motif(s):
 
Type Positions Sequence
24 -> 308 GKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQERFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGNFHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMATSGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLTKQLGRSVY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
molecular_function GO:0016787 - hydrolase activity
GO:0004359 - glutaminase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006537 - glutamate biosynthetic process
GO:0006541 - glutamine metabolic process
GO:0045926 - negative regulation of growth
GO:0006543 - glutamine catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12757N
ECOCYC:
G6810-MONOMER
ECOLIWIKI:
b1524
INTERPRO:
IPR015868
INTERPRO:
IPR012338
MODBASE:
P0A6W0
PANTHER:
PTHR12544
PFAM:
PF04960
PRIDE:
P0A6W0
PRODB:
PRO_000022802
REFSEQ:
NP_416041
SMR:
P0A6W0
UNIPROT:
P0A6W0


Operon      
Name: glsB-yneG         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1837 1611861 reverse nd [RS-EPT-CBR] [1]
  promoter yneFp7 1611874 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1838 1611884 reverse nd [RS-EPT-CBR] [1]



RegulonDB