RegulonDB RegulonDB 10.7: Gene Form
   

ydfZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfI ydfH ydfZ terminator TSS_1851 TSS_1851

Gene      
Name: ydfZ    Texpresso search in the literature
Synonym(s): ECK1534, G6815, b1541
Genome position(nucleotides): 1629215 --> 1629418 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.96
External database links:  
ASAP:
ABE-0005147
ECHOBASE:
EB3599
OU-MICROARRAY:
b1541
PORTECO:
ydfZ
REGULONDB:
b1541
STRING:
511145.b1541
M3D: ydfZ
COLOMBOS: ydfZ
PortEco: b1541


Product      
Name: putative selenoprotein YdfZ
Synonym(s): YdfZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.276
Isoelectric point: 8.521
Motif(s):
 
Type Positions Sequence
2 -> 65 TTYDRNRNAITTGSRVMVSGTGHTGKILSIDTEGLTAEQIRRGKTVVVEGCEEKLAPLDLIRLG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48219N
ECOCYC:
G6815-MONOMER
ECOLIWIKI:
b1541
INTERPRO:
IPR017704
PFAM:
PF14001
PRIDE:
P64463
PROTEINMODELPORTAL:
P64463
REFSEQ:
NP_416059
UNIPROT:
P64463


Operon      
Name: ydfZ         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1851 1629168 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB