RegulonDB RegulonDB 10.7: Gene Form
   

ydfI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfI ydfJ ydfZ anti-anti-terminator anti-terminator terminator

Gene      
Name: ydfI    Texpresso search in the literature
Synonym(s): ECK1535, G6816, b1542
Genome position(nucleotides): 1629453 <-- 1630913 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.49
External database links:  
ASAP:
ABE-0005149
ECHOBASE:
EB3582
OU-MICROARRAY:
b1542
PORTECO:
ydfI
REGULONDB:
b1542
STRING:
511145.b1542
M3D: ydfI
COLOMBOS: ydfI
PortEco: b1542


Product      
Name: putative oxidoreductase YdfI
Synonym(s): YdfI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.685
Isoelectric point: 5.397
Motif(s):
 
Type Positions Sequence
23 -> 185 RIVHLGFGAFHRAHQGVYADILATEHFSDWGYYEVNLIGGEQQIADLQQQDNLYTVAEMSADVWTARVVGVVKKALHVQIDGLETVLAAMCEPQIAIVSLTITEKGYFHSPATGQLMLDHPMVAADVQNPHQPKTATGVIVEALARRKAAGLPAFTVMSCDNM
213 -> 459 DNVTFPSTMVDRIVPAVTEDTLAKIEQLTGVRDPAGVACEPFRQWVIEDNFVAGRPEWEKAGAELVSDVLPYEEMKLRMLNGSHSFLAYLGYLAGYQHINDCMEDEHYRYAAYGLMLQEQAPTLKVQGVDLQDYANRLIARYSNPALRHRTWQIAMDGSQKLPQRMLDSVRWHLAHDSKFDLLALGVAGWMRYVGGVDEQGNPIEISDPLLPVIQKAVQSSAEGKARVQSLLAIKAIFGDDLPDNSL
24 -> 35 IVHLGFGAFHRA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0050662 - coenzyme binding
biological_process GO:0055114 - oxidation-reduction process
GO:0019594 - mannitol metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6816-MONOMER
ECOLIWIKI:
b1542
INTERPRO:
IPR023027
INTERPRO:
IPR013118
INTERPRO:
IPR013131
INTERPRO:
IPR013328
INTERPRO:
IPR000669
INTERPRO:
IPR036291
INTERPRO:
IPR008927
MODBASE:
P77260
PFAM:
PF01232
PFAM:
PF08125
PRIDE:
P77260
PRINTS:
PR00084
PROSITE:
PS00974
PROTEINMODELPORTAL:
P77260
REFSEQ:
NP_416060
SMR:
P77260
UNIPROT:
P77260


Operon      
Name: ydfI         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB