RegulonDB RegulonDB 10.7: Gene Form
   

pinQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pinQ tfaQ ydfK TSS_1861 TSS_1861 pinQp1 pinQp1

Gene      
Name: pinQ    Texpresso search in the literature
Synonym(s): ECK1538, G6819, b1545, ydfL
Genome position(nucleotides): 1633622 --> 1634212 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.84
External database links:  
ASAP:
ABE-0005164
ECHOBASE:
EB3585
OU-MICROARRAY:
b1545
PORTECO:
pinQ
REGULONDB:
b1545
STRING:
511145.b1545
M3D: pinQ
COLOMBOS: pinQ
PortEco: b1545


Product      
Name: Qin prophage; putative site-specific recombinase
Synonym(s): PinQ, YdfL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.852
Isoelectric point: 10.379
Motif(s):
 
Type Positions Sequence
5 -> 144 FAYCRISTLDQTTENQRREIESAGFKIKPQQIIEEHISGSAATSERPGFNRLLARLKCGDQLIVTKLDRLGCNAMDIRKTVEQLTETGIRVHCLALGGIDLTSPTGKMMMQVISAVAEFERDLLLERTHSGIVRARGAGK
147 -> 190 GRPPVLNEEQKQAVFERIKSGVSISAIAREFKTSRQTILRAKAK
3 -> 143 QIFAYCRISTLDQTTENQRREIESAGFKIKPQQIIEEHISGSAATSERPGFNRLLARLKCGDQLIVTKLDRLGCNAMDIRKTVEQLTETGIRVHCLALGGIDLTSPTGKMMMQVISAVAEFERDLLLERTHSGIVRARGAG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0016787 - hydrolase activity
GO:0016874 - ligase activity
GO:0000150 - recombinase activity
biological_process GO:0006310 - DNA recombination
GO:0015074 - DNA integration
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10508N
ECOCYC:
G6819-MONOMER
ECOLIWIKI:
b1545
INTERPRO:
IPR036162
INTERPRO:
IPR006120
INTERPRO:
IPR006119
INTERPRO:
IPR006118
INTERPRO:
IPR009057
MODBASE:
P77170
PFAM:
PF02796
PFAM:
PF00239
PRIDE:
P77170
PROSITE:
PS51736
PROSITE:
PS00398
PROTEINMODELPORTAL:
P77170
REFSEQ:
NP_416063
SMART:
SM00857
SMR:
P77170
UNIPROT:
P77170


Operon      
Name: pinQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pinQp1 1633584 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1861 1633598 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB