RegulonDB RegulonDB 10.7: Gene Form
   

stfQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

stfQ pinQ tfaQ nohA ynfO Fur Fur ynfOp1 ynfOp1 nohAp nohAp tfaQp6 tfaQp6

Gene      
Name: stfQ    Texpresso search in the literature
Synonym(s): ECK1540, G6821, b1547, ydfN
Genome position(nucleotides): 1634885 <-- 1635847 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.65
External database links:  
ASAP:
ABE-0005168
ECHOBASE:
EB3587
OU-MICROARRAY:
b1547
PORTECO:
ydfN
REGULONDB:
b1547
STRING:
511145.b1547
M3D: stfQ
COLOMBOS: stfQ
PortEco: b1547


Product      
Name: Qin prophage; putative prophage side tail fiber protein StfQ
Synonym(s): StfQ, YdfN
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 32.902
Isoelectric point: 7.644
Motif(s):
 
Type Positions Sequence
94 -> 140 GAPIPWPSDTVPSGYALMQGQTFDKSAYPKLAVAYPSGVIPDMRGWT
279 -> 290 GIGAHTHSVAIG
255 -> 268 SSDGAHTHSLSGTA
157 -> 170 DGIKSHTHSASASS
189 -> 202 NNTGAHTHSISGTA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0005198 - structural molecule activity
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10931N
ECOCYC:
G6821-MONOMER
ECOLIWIKI:
b1547
INTERPRO:
IPR011083
INTERPRO:
IPR005003
INTERPRO:
IPR037053
MODBASE:
P77515
PFAM:
PF07484
PFAM:
PF03335
PRIDE:
P77515
PRODB:
PRO_000023998
PROTEINMODELPORTAL:
P77515
REFSEQ:
NP_416065
SMR:
P77515
UNIPROT:
P77515


Operon      
Name: nohA-stfQ-tfaQ         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tfaQp6 1634956 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ynfOp1 1636727 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB