RegulonDB RegulonDB 10.7: Gene Form
   

ydfO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfO ynfO gnsB

Gene      
Name: ydfO    Texpresso search in the literature
Synonym(s): ECK1543, G6822, b1549
Genome position(nucleotides): 1637047 --> 1637457 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
31.63
External database links:  
ASAP:
ABE-0005175
ECHOBASE:
EB3588
OU-MICROARRAY:
b1549
PORTECO:
ydfO
REGULONDB:
b1549
STRING:
511145.b1549
M3D: ydfO
COLOMBOS: ydfO
PortEco: b1549


Product      
Name: Qin prophage; DUF1398 domain-containing protein YdfO
Synonym(s): YdfO
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 16.497
Isoelectric point: 10.233
Motif(s):
 
Type Positions Sequence
8 -> 125 KQIFDKVRNDLNYQWFYSELKRHNVSHYIYYLATENVHIVLKNDNTVLLKGLKNIVSVKFSKDRHLIETTSNKLKSREITFQEYRRNLAKAGVFRWVTNIHEQKRYYYTFDNSLLFTE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6822-MONOMER
ECOLIWIKI:
b1549
INTERPRO:
IPR009833
INTERPRO:
IPR036696
PDB:
2HH8
PFAM:
PF07166
PRIDE:
P76156
PRODOM:
PD021249
PROTEINMODELPORTAL:
P76156
REFSEQ:
NP_416067
SMR:
P76156
UNIPROT:
P76156


Operon      
Name: ynfO-ydfO         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB