RegulonDB RegulonDB 10.8: Gene Form
   

gnsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfO gnsB ynfN gnsBp gnsBp

Gene      
Name: gnsB    Texpresso search in the literature
Synonym(s): ECK1544, G6823, b1550, ydfY
Genome position(nucleotides): 1637609 <-- 1637782 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
29.89
External database links:  
ASAP:
ABE-0005177
ECHOBASE:
EB3598
OU-MICROARRAY:
b1550
PortEco:
gnsB
STRING:
511145.b1550
COLOMBOS: gnsB


Product      
Name: Qin prophage; protein GnsB
Synonym(s): GnsB, YdfY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 6.548
Isoelectric point: 9.604
Motif(s):
 
Type Positions Sequence
1 -> 54 MNIENLKTKAEADISEYITKKIIELKKKTGKEVTSIQFTAREKMTGLESYDVKI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006636 - unsaturated fatty acid biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Sugai R., et al., 2001
External database links:  
ECOCYC:
G6823-MONOMER
ECOLIWIKI:
b1550
INTERPRO:
IPR012563
PFAM:
PF08178
PRIDE:
P77695
PRODB:
PRO_000022824
REFSEQ:
NP_416068
SMR:
P77695
UNIPROT:
P77695


Operon      
Name: gnsB         
Operon arrangement:
Transcription unit        Promoter
gnsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sugai R., Shimizu H., Nishiyama K., Tokuda H., 2001, Overexpression of yccL (gnsA) and ydfY (gnsB) increases levels of unsaturated fatty acids and suppresses both the temperature-sensitive fabA6 mutation and cold-sensitive secG null mutation of Escherichia coli., J Bacteriol 183(19):5523-8


RegulonDB