RegulonDB RegulonDB 10.7: Gene Form
   

gnsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfO gnsB ynfN gnsBp gnsBp

Gene      
Name: gnsB    Texpresso search in the literature
Synonym(s): ECK1544, G6823, b1550, ydfY
Genome position(nucleotides): 1637609 <-- 1637782 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
29.89
External database links:  
ASAP:
ABE-0005177
ECHOBASE:
EB3598
OU-MICROARRAY:
b1550
PORTECO:
gnsB
REGULONDB:
b1550
STRING:
511145.b1550
M3D: gnsB
COLOMBOS: gnsB
PortEco: b1550


Product      
Name: Qin prophage; protein GnsB
Synonym(s): GnsB, YdfY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 6.548
Isoelectric point: 9.604
Motif(s):
 
Type Positions Sequence
1 -> 54 MNIENLKTKAEADISEYITKKIIELKKKTGKEVTSIQFTAREKMTGLESYDVKI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006636 - unsaturated fatty acid biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Sugai R., et al., 2001
External database links:  
ECOCYC:
G6823-MONOMER
ECOLIWIKI:
b1550
INTERPRO:
IPR012563
PFAM:
PF08178
PRIDE:
P77695
PRODB:
PRO_000022824
PROTEINMODELPORTAL:
P77695
REFSEQ:
NP_416068
SMR:
P77695
UNIPROT:
P77695


Operon      
Name: gnsB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sugai R., Shimizu H., Nishiyama K., Tokuda H., 2001, Overexpression of yccL (gnsA) and ydfY (gnsB) increases levels of unsaturated fatty acids and suppresses both the temperature-sensitive fabA6 mutation and cold-sensitive secG null mutation of Escherichia coli., J Bacteriol 183(19):5523-8


RegulonDB