RegulonDB RegulonDB 10.7: Gene Form
   

cspI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rzpQ rzoQ cspI ynfQ rrrQ BasR Fis Fis Fis Fis Fis Fis Cis-reg; thermoregulator cspIp cspIp cspIp2 cspIp2 ynfNp6 ynfNp6

Gene      
Name: cspI    Texpresso search in the literature
Synonym(s): ECK1546, G6825, b1552, cspJ
Genome position(nucleotides): 1638455 <-- 1638667 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.38
External database links:  
ASAP:
ABE-0005183
ECHOBASE:
EB3636
OU-MICROARRAY:
b1552
PORTECO:
cspI
REGULONDB:
b1552
STRING:
511145.b1552
M3D: cspI
COLOMBOS: cspI
PortEco: b1552


Product      
Name: Qin prophage; cold shock protein CspI
Synonym(s): CspI, CspJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.684
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
7 -> 67 GLVKWFNPEKGFGFITPKDGSKDVFVHFSAIQSNDFKTLTENQEVEFGIENGPKGPAAVHV
5 -> 69 MTGLVKWFNPEKGFGFITPKDGSKDVFVHFSAIQSNDFKTLTENQEVEFGIENGPKGPAAVHVVA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0009409 - response to cold
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
Reference(s): [1] Czapski TR., et al., 2014
[2] Wang N., et al., 1999
External database links:  
DIP:
DIP-48195N
ECOCYC:
G6825-MONOMER
ECOLIWIKI:
b1552
INTERPRO:
IPR012156
INTERPRO:
IPR019844
INTERPRO:
IPR012340
INTERPRO:
IPR002059
INTERPRO:
IPR011129
MINT:
MINT-1309031
MODBASE:
P0A986
PFAM:
PF00313
PRIDE:
P0A986
PRINTS:
PR00050
PRODB:
PRO_000022344
PROSITE:
PS51857
PROSITE:
PS00352
PROTEINMODELPORTAL:
P0A986
REFSEQ:
NP_416070
SMART:
SM00357
SMR:
P0A986
SWISSMODEL:
P0A986
UNIPROT:
P0A986


Operon      
Name: cspI         
Operon arrangement:
Transcription unit        Promoter
 
cspI


Transcriptional Regulation      
Display Regulation             
Activated by: BasR
Repressed by: Fis


RNA cis-regulatory element    
   
Cis-reg; thermoregulator cspA thermoregulator
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ynfNp6 1638299 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Czapski TR., Trun N., 2014, Expression of csp genes in E. coli K-12 in defined rich and defined minimal media during normal growth, and after cold-shock., Gene 547(1):91-7

 [2] Wang N., Yamanaka K., Inouye M., 1999, CspI, the ninth member of the CspA family of Escherichia coli, is induced upon cold shock., J Bacteriol 181(5):1603-9

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB