RegulonDB RegulonDB 10.7: Gene Form
   

rzpQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rrrQ rzpQ rzoQ cspI ydfR BasR Fis Fis Fis Fis Fis Fis Cis-reg; thermoregulator cspIp cspIp cspIp2 cspIp2

Gene      
Name: rzpQ    Texpresso search in the literature
Synonym(s): ECK1547, G6826, b1553, ydfP
Genome position(nucleotides): 1639030 <-- 1639527 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.78
External database links:  
ASAP:
ABE-0005187
ECHOBASE:
EB3589
OU-MICROARRAY:
b1553
PORTECO:
ydfP
REGULONDB:
b1553
M3D: rzpQ
COLOMBOS: rzpQ
PortEco: b1553


Product      
Name: Qin prophage; DUF2514 domain-containing protein RzpQ
Synonym(s): RzpQ, YdfP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.31
Isoelectric point: 8.434
Motif(s):
 
Type Positions Sequence
1 -> 22 MNQIFMVIFLVLSGFIVGNVWS
23 -> 165 DRGWQKKWAERDAAALSQEVNAQFAARIIEQGRTIARDEAVKDAQQKSAEISARAAYLSDSVNQLRAEAKKYAIRLDAAKHTADLAAAVRGKTTKTAEGMLTNMLGDIAAEAQLYAEIADERYIAGVTCQQIYESLRDKKHQM
4 -> 159 IFMVIFLVLSGFIVGNVWSDRGWQKKWAERDAAALSQEVNAQFAARIIEQGRTIARDEAVKDAQQKSAEISARAAYLSDSVNQLRAEAKKYAIRLDAAKHTADLAAAVRGKTTKTAEGMLTNMLGDIAAEAQLYAEIADERYIAGVTCQQIYESLR

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6826-MONOMER
ECOLIWIKI:
b1553
INTERPRO:
IPR019659
PFAM:
PF10721
PRIDE:
P76158
PROTEINMODELPORTAL:
P76158
REFSEQ:
NP_416071
UNIPROT:
P76158


Operon      
Name: essQ-ydfR-rrrQ-rzpQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB