RegulonDB RegulonDB 10.7: Gene Form
   

rrrQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rrrQ rzpQ ydfR rzoQ essQ terminator

Gene      
Name: rrrQ    Texpresso search in the literature
Synonym(s): ECK1548, G6827, b1554, ydfQ
Genome position(nucleotides): 1639524 <-- 1640057 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.56
External database links:  
ASAP:
ABE-0005189
ECHOBASE:
EB3590
OU-MICROARRAY:
b1554
PORTECO:
ydfQ
REGULONDB:
b1554
STRING:
511145.b1554
M3D: rrrQ
COLOMBOS: rrrQ
PortEco: b1554


Product      
Name: Qin prophage; putative lysozyme
Synonym(s): RrrQ, YdfQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 19.663
Isoelectric point: 8.931
Motif(s):
 
Type Positions Sequence
48 -> 166 IWTICRGATVVDGKTVFPNMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0003796 - lysozyme activity
biological_process GO:0008152 - metabolic process
GO:0009253 - peptidoglycan catabolic process
GO:0016998 - cell wall macromolecule catabolic process
GO:0019835 - cytolysis
GO:0042742 - defense response to bacterium
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6827-MONOMER
ECOLIWIKI:
b1554
INTERPRO:
IPR002196
INTERPRO:
IPR023346
MODBASE:
P76159
PFAM:
PF00959
PRIDE:
P76159
PROTEINMODELPORTAL:
P76159
REFSEQ:
NP_416072
SMR:
P76159
UNIPROT:
P76159


Operon      
Name: essQ-ydfR-rrrQ-rzpQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB